Recombinant Human FTO protein, GST-tagged
Cat.No. : | FTO-3628H |
Product Overview : | Recombinant Human FTO protein(400-505 aa), fused to GST tag, was expressed in E. coli. |
Availability | June 10, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 400-505 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH. |
AA Sequence : | MAQLEALWKKMEGVTNAVLHEVKREGLPVEQRNEILTAILASLTARQNLRREWHARCQSRIARTLPADQKPECRPYWEKDDASMPLPFDLTDIVSELRGQLLEAKP |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | FTO fat mass and obesity associated [ Homo sapiens ] |
Official Symbol | FTO |
Synonyms | FTO; fat mass and obesity associated; alpha-ketoglutarate-dependent dioxygenase FTO; KIAA1752; MGC5149; protein fto; fat mass and obesity-associated protein; |
Gene ID | 79068 |
mRNA Refseq | NM_001080432 |
Protein Refseq | NP_001073901 |
MIM | 610966 |
UniProt ID | Q9C0B1 |
◆ Recombinant Proteins | ||
Fto-273R | Recombinant Rat Fto, His-tagged | +Inquiry |
FTO-170HF | Recombinant Full Length Human FTO Protein, GST-tagged | +Inquiry |
Fto-2127M | Recombinant Mouse Fat Mass And Obesity Associated, His-tagged | +Inquiry |
FTO-1054H | Recombinant Human FTO Protein (T32-P505), Tag Free | +Inquiry |
Fto-3101M | Recombinant Mouse Fto Protein, Myc/DDK-tagged | +Inquiry |
◆ Native Proteins | ||
FTO-025H | Active Recombinant Human FTO Protein, His tagged | +Inquiry |
FTO-05HFL | Active Recombinant Full Length Human FTO Protein, FLAG tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FTO Products
Required fields are marked with *
My Review for All FTO Products
Required fields are marked with *
0
Inquiry Basket