Recombinant Human FTO protein, GST-tagged
| Cat.No. : | FTO-3628H |
| Product Overview : | Recombinant Human FTO protein(400-505 aa), fused to GST tag, was expressed in E. coli. |
| Availability | July 28, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 400-505 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH. |
| AA Sequence : | MAQLEALWKKMEGVTNAVLHEVKREGLPVEQRNEILTAILASLTARQNLRREWHARCQSRIARTLPADQKPECRPYWEKDDASMPLPFDLTDIVSELRGQLLEAKP |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | FTO fat mass and obesity associated [ Homo sapiens ] |
| Official Symbol | FTO |
| Synonyms | FTO; fat mass and obesity associated; alpha-ketoglutarate-dependent dioxygenase FTO; KIAA1752; MGC5149; protein fto; fat mass and obesity-associated protein; |
| Gene ID | 79068 |
| mRNA Refseq | NM_001080432 |
| Protein Refseq | NP_001073901 |
| MIM | 610966 |
| UniProt ID | Q9C0B1 |
| ◆ Recombinant Proteins | ||
| FTO-2685H | Recombinant Human FTO Protein (Mer1-Pro505), N-His tagged | +Inquiry |
| FTO-118H | Recombinant Human FTO, GST-tagged | +Inquiry |
| FTO-2663H | Recombinant Human FTO Protein, MYC/DDK-tagged | +Inquiry |
| FTO-1055H | Recombinant Human FTO Protein (T32-P505), His tagged | +Inquiry |
| Fto-273R | Recombinant Rat Fto, His-tagged | +Inquiry |
| ◆ Native Proteins | ||
| FTO-025H | Active Recombinant Human FTO Protein, His tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FTO Products
Required fields are marked with *
My Review for All FTO Products
Required fields are marked with *



