Recombinant Mouse Fxn protein, His-SUMO-tagged
Cat.No. : | Fxn-2932M |
Product Overview : | Recombinant Mouse Fxn protein(O35943)(78-207aa), fused to N-terminal His tag and SUMO tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 78-207aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 30.4 kDa |
AA Sequence : | LGTLDNPSSLDETAYERLAEETLDSLAEFFEDLADKPYTLEDYDVSFGDGVLTIKLGGDLGTYVINKQTPNKQIWLSSPSSGPKRYDWTGKNWVYSHDGVSLHELLARELTKALNTKLDLSSLAYSGKGT |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | Fxn frataxin [ Mus musculus ] |
Official Symbol | Fxn |
Synonyms | FXN; frataxin; frataxin, mitochondrial; Friedreich ataxia; FA; X25; FARR; Frda; |
Gene ID | 14297 |
mRNA Refseq | NM_008044 |
Protein Refseq | NP_032070 |
◆ Recombinant Proteins | ||
FXN-4372H | Recombinant Human FXN protein, His-SUMO & Myc-tagged | +Inquiry |
FXN-1060M | Recombinant Cynomolgus Monkey FXN Protein (81-210 aa), His-tagged | +Inquiry |
Fxn-7819M | Recombinant Mouse Fxn protein, His & T7-tagged | +Inquiry |
FXN-1771R | Recombinant Rhesus monkey FXN Protein, His-tagged | +Inquiry |
FxN-4373H | Recombinant Human FxN protein, His&Myc-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FXN-6108HCL | Recombinant Human FXN 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Fxn Products
Required fields are marked with *
My Review for All Fxn Products
Required fields are marked with *