Recombinant Human FXYD2 Protein, GST-tagged
Cat.No. : | FXYD2-4579H |
Product Overview : | Human FXYD2 full-length ORF ( AAH05302.1, 1 a.a. - 64 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a member of a family of small membrane proteins that share a 35-amino acid signature sequence domain, beginning with the sequence PFXYD and containing 7 invariant and 6 highly conserved amino acids. The approved human gene nomenclature for the family is FXYD-domain containing ion transport regulator. Mouse FXYD5 has been termed RIC (Related to Ion Channel). FXYD2, also known as the gamma subunit of the Na,K-ATPase, regulates the properties of that enzyme. FXYD1 (phospholemman), FXYD2 (gamma), FXYD3 (MAT-8), FXYD4 (CHIF), and FXYD5 (RIC) have been shown to induce channel activity in experimental expression systems. Transmembrane topology has been established for two family members (FXYD1 and FXYD2), with the N-terminus extracellular and the C-terminus on the cytoplasmic side of the membrane. The Type III integral membrane protein encoded by this gene is the gamma subunit of the Na,K-ATPase present on the plasma membrane. Although the Na,K-ATPase does not depend on the gamma subunit to be functional, it is thought that the gamma subunit modulates the enzymes activity by inducing ion channel activity. Mutations in this gene have been associated with renal hypomagnesaemia. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq |
Molecular Mass : | 32.78 kDa |
AA Sequence : | MDRWYLGGSPKGDVDPFYYDYETVRNGGLIFAGLAFIVGLLILLSRRFRCGGNKKRRQINEDEP |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | FXYD2 FXYD domain containing ion transport regulator 2 [ Homo sapiens ] |
Official Symbol | FXYD2 |
Synonyms | FXYD2; FXYD domain containing ion transport regulator 2; ATP1G1, HOMG2, hypomagnesemia 2, renal; sodium/potassium-transporting ATPase subunit gamma; MGC12372; sodium pump gamma chain; Na(+)/K(+) ATPase subunit gamma; ATPase, Na+/K+ transporting, gamma 1 polypeptide; HOMG2; ATP1G1; |
Gene ID | 486 |
mRNA Refseq | NM_001680 |
Protein Refseq | NP_001671 |
MIM | 601814 |
UniProt ID | P54710 |
◆ Cell & Tissue Lysates | ||
FXYD2-6103HCL | Recombinant Human FXYD2 293 Cell Lysate | +Inquiry |
FXYD2-6102HCL | Recombinant Human FXYD2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FXYD2 Products
Required fields are marked with *
My Review for All FXYD2 Products
Required fields are marked with *
0
Inquiry Basket