Recombinant Full Length Xenopus Laevis Sodium/Potassium-Transporting Atpase Subunit Gamma(Fxyd2) Protein, His-Tagged
Cat.No. : | RFL26733XF |
Product Overview : | Recombinant Full Length Xenopus laevis Sodium/potassium-transporting ATPase subunit gamma(fxyd2) Protein (O13001) (1-61aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Xenopus laevis |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-61) |
Form : | Lyophilized powder |
AA Sequence : | MADAQDDMSQMQDKFTYDYETIRKGGLIFAAIAFVVGMLIIFSGRFRCGRKKQLRALNDD M |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | fxyd2 |
Synonyms | fxyd2; Sodium/potassium-transporting ATPase subunit gamma; Na(+/K(+ ATPase subunit gamma; FXYD domain-containing ion transport regulator 2; Sodium pump gamma chain |
UniProt ID | O13001 |
◆ Recombinant Proteins | ||
FXYD2-5278HF | Recombinant Full Length Human FXYD2 Protein, GST-tagged | +Inquiry |
FXYD2-4579H | Recombinant Human FXYD2 Protein, GST-tagged | +Inquiry |
FXYD2-551H | Recombinant Human FXYD2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
RFL21318HF | Recombinant Full Length Human Sodium/Potassium-Transporting Atpase Subunit Gamma(Fxyd2) Protein, His-Tagged | +Inquiry |
FXYD2-2421R | Recombinant Rat FXYD2 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
FXYD2-6102HCL | Recombinant Human FXYD2 293 Cell Lysate | +Inquiry |
FXYD2-6103HCL | Recombinant Human FXYD2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All fxyd2 Products
Required fields are marked with *
My Review for All fxyd2 Products
Required fields are marked with *
0
Inquiry Basket