Recombinant Full Length Human Sodium/Potassium-Transporting Atpase Subunit Gamma(Fxyd2) Protein, His-Tagged
| Cat.No. : | RFL21318HF |
| Product Overview : | Recombinant Full Length Human Sodium/potassium-transporting ATPase subunit gamma(FXYD2) Protein (P54710) (1-66aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | Full Length (1-66) |
| Form : | Lyophilized powder |
| AA Sequence : | MTGLSMDGGGSPKGDVDPFYYDYETVRNGGLIFAGLAFIVGLLILLSRRFRCGGNKKRRQINEDEP |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Applications : | SDS-PAGE |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Gene Name | FXYD2 |
| Synonyms | FXYD2; ATP1C; ATP1G1; Sodium/potassium-transporting ATPase subunit gamma; Na(+)/K(+) ATPase subunit gamma; FXYD domain-containing ion transport regulator 2; Sodium pump gamma chain |
| UniProt ID | P54710 |
| ◆ Recombinant Proteins | ||
| RFL21318HF | Recombinant Full Length Human Sodium/Potassium-Transporting Atpase Subunit Gamma(Fxyd2) Protein, His-Tagged | +Inquiry |
| FXYD2-3401M | Recombinant Mouse FXYD2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| FXYD2-4579H | Recombinant Human FXYD2 Protein, GST-tagged | +Inquiry |
| FXYD2-2139H | Recombinant Human FXYD2 Protein (1-64 aa), GST-tagged | +Inquiry |
| FXYD2-5278HF | Recombinant Full Length Human FXYD2 Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| FXYD2-6103HCL | Recombinant Human FXYD2 293 Cell Lysate | +Inquiry |
| FXYD2-6102HCL | Recombinant Human FXYD2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FXYD2 Products
Required fields are marked with *
My Review for All FXYD2 Products
Required fields are marked with *




