Recombinant Human FZD10 protein, His-tagged
| Cat.No. : | FZD10-2184H |
| Product Overview : | Recombinant Human FZD10 protein(NP_009128)(23-229 aa), fused to His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 23-229 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.). 5 % trehalose and 5 % mannitol are added as protectants before lyophilization. |
| AA Sequence : | SMDMERPGDGKCQPIEIPMCKDIGYNMTRMPNLMGHENQREAAIQLHEFAPLVEYGCHGHLRFFLCSLYAPMCTEQVSTPIPACRVMCEQARLKCSPIMEQFNFKWPDSLDCRKLPNKNDPNYLCMEAPNNGSDEPTRGSGLFPPLFRPQRPHSAQEHPLKDGGPGRGGCDNPGKFHHVEKSASCAPLCTPGVDVYWSREDKRFAVV |
| Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | FZD10 frizzled family receptor 10 [ Homo sapiens ] |
| Official Symbol | FZD10 |
| Synonyms | FZD10; frizzled family receptor 10; frizzled (Drosophila) homolog 10 , frizzled 10, seven transmembrane spanning receptor , frizzled homolog 10 (Drosophila); frizzled-10; CD350; frizzled homolog 10; frizzled 10, seven transmembrane spanning receptor; Fz10; FzE7; FZ-10; hFz10; |
| Gene ID | 11211 |
| mRNA Refseq | NM_007197 |
| Protein Refseq | NP_009128 |
| MIM | 606147 |
| UniProt ID | Q9ULW2 |
| ◆ Recombinant Proteins | ||
| FZD10-284H | Recombinant Human FZD10, His-tagged | +Inquiry |
| Fzd10-4042M | Recombinant Mouse Fzd10 protein(Met1-Gly162), hFc-tagged | +Inquiry |
| FZD10-581H | Active Recombinant Human Frizzled Family Receptor 10, Fc-tagged | +Inquiry |
| Fzd10-52M | Recombinant Mouse Fzd10 Protein, His (Fc)-Avi-tagged | +Inquiry |
| Fzd10-276M | Active Recombinant Mouse Fzd10 protein, Fc-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| FZD10-2118MCL | Recombinant Mouse FZD10 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FZD10 Products
Required fields are marked with *
My Review for All FZD10 Products
Required fields are marked with *
