Recombinant Human FZD10 protein, His-tagged
Cat.No. : | FZD10-2184H |
Product Overview : | Recombinant Human FZD10 protein(NP_009128)(23-229 aa), fused to His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 23-229 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.). 5 % trehalose and 5 % mannitol are added as protectants before lyophilization. |
AA Sequence : | SMDMERPGDGKCQPIEIPMCKDIGYNMTRMPNLMGHENQREAAIQLHEFAPLVEYGCHGHLRFFLCSLYAPMCTEQVSTPIPACRVMCEQARLKCSPIMEQFNFKWPDSLDCRKLPNKNDPNYLCMEAPNNGSDEPTRGSGLFPPLFRPQRPHSAQEHPLKDGGPGRGGCDNPGKFHHVEKSASCAPLCTPGVDVYWSREDKRFAVV |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | FZD10 frizzled family receptor 10 [ Homo sapiens ] |
Official Symbol | FZD10 |
Synonyms | FZD10; frizzled family receptor 10; frizzled (Drosophila) homolog 10 , frizzled 10, seven transmembrane spanning receptor , frizzled homolog 10 (Drosophila); frizzled-10; CD350; frizzled homolog 10; frizzled 10, seven transmembrane spanning receptor; Fz10; FzE7; FZ-10; hFz10; |
Gene ID | 11211 |
mRNA Refseq | NM_007197 |
Protein Refseq | NP_009128 |
MIM | 606147 |
UniProt ID | Q9ULW2 |
◆ Recombinant Proteins | ||
FZD10-79H | Recombinant Human FZD10 Protein, His (Fc)-Avi-tagged | +Inquiry |
FZD10-293H | Active Recombinant Human FZD10 Full Length Transmembrane protein(Nanodisc) | +Inquiry |
FZD10-8558Z | Recombinant Zebrafish FZD10 | +Inquiry |
FZD10-283H | Recombinant Human FZD10, Fc-tagged | +Inquiry |
FZD10-13H | Recombinant Human frizzled class receptor 10 Protein, His&Fc tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FZD10-2118MCL | Recombinant Mouse FZD10 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FZD10 Products
Required fields are marked with *
My Review for All FZD10 Products
Required fields are marked with *