Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at IMMUNOLOGY2024™|May 3-7, 2024|Booth #512

Recombinant Human GABA(A) receptor-associated protein, His-tagged

Cat.No. : GABARAP-4365H
Product Overview : GABARAP Human Recombinant produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 137 amino acids (1-117 a.a.) and having a molecular mass of 16 kDa. GABARAP is fused to a 20 amino acid His-Tag at N-Terminus and purified by proprietary chromatographic techniques.
  • Specification
  • Gene Information
  • Related Products
Cat. No. : GABARAP-4365H
Description : GABARAP is a ligand-gated chloride channel that mediates inhibitory neurotransmission. GABARAP is highly positively charged in its N-terminus and shares sequence similarity with light chain-3 of microtubule-associated proteins 1A and 1B. GABARAP clusters neurotransmitter receptors by mediating interaction with the cytoskeleton.
Source : Human
Host : Escherichia Coli
Form : GABARAP solution containing 20mM Tris pH-8, 0.2M NaCl and 20% glycerol.
Purity : Greater than 95% as determined by SDS-PAGE.
Physical Appearance : Sterile filtered colorless solution.
Amino Acid Sequence : MGSSHHHHHHSSGLVPRGSHMKFVYKEEHPFEKRRSE GEKIRKKYPDRVPVIVEKAPKARIGDLDKKKYLVPSDLTVG QFYFLIRKRIHLRAEDALFFFVNNVIPPTSATMGQLYQEHH EEDFFLYIAYSDESVYGL.
Storage : GABARAP Human Recombinant although stable at 4°C for 1 week, should be stored below -18°C. Please prevent freeze thaw cycles.
Pathways : Regulation of autophagy
Functions : GABA receptor binding; beta-tubulin binding; microtubule binding; protein binding
Gene Name : GABARAP GABA(A) receptor-associated protein [ Homo sapiens ]
Official Symbol : GABARAP
Synonyms : GABARAP; GABA(A) receptor-associated protein; MM46; FLJ25768; MGC120154; MGC120155; Gamma-aminobutyric acid receptor-associated protein; FLC3B
Gene ID : 11337
mRNA Refseq : NM_007278
Protein Refseq : NP_009209
MIM : 605125
UniProt ID : O95166
Chromosome Location : 17

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

0

Inquiry Basket

cartIcon
logo

FOLLOW US

Terms and Conditions        Privacy Policy

Copyright © 2024 Creative BioMart. All Rights Reserved.

Contact Us

  • /

Stay Updated on the Latest Bioscience Trends