Recombinant Human GABA(A) receptor-associated protein, His-tagged
| Cat.No. : | GABARAP-4365H |
| Product Overview : | GABARAP Human Recombinant produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 137 amino acids (1-117 a.a.) and having a molecular mass of 16 kDa. GABARAP is fused to a 20 amino acid His-Tag at N-Terminus and purified by proprietary chromatographic techniques. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Human |
| Tag : | His |
| Protein Length : | 1-117 a.a. |
| Description : | GABARAP is a ligand-gated chloride channel that mediates inhibitory neurotransmission. GABARAP is highly positively charged in its N-terminus and shares sequence similarity with light chain-3 of microtubule-associated proteins 1A and 1B. GABARAP clusters neurotransmitter receptors by mediating interaction with the cytoskeleton. |
| Form : | GABARAP solution containing 20mM Tris pH-8, 0.2M NaCl and 20% glycerol. |
| Purity : | Greater than 95% as determined by SDS-PAGE. |
| Physical Appearance : | Sterile filtered colorless solution. |
| Amino Acid Sequence : | MGSSHHHHHHSSGLVPRGSHMKFVYKEEHPFEKRRSE GEKIRKKYPDRVPVIVEKAPKARIGDLDKKKYLVPSDLTVG QFYFLIRKRIHLRAEDALFFFVNNVIPPTSATMGQLYQEHH EEDFFLYIAYSDESVYGL. |
| Storage : | GABARAP Human Recombinant although stable at 4°C for 1 week, should be stored below -18°C. Please prevent freeze thaw cycles. |
| Pathways : | Regulation of autophagy |
| Functions : | GABA receptor binding; beta-tubulin binding; microtubule binding; protein binding |
| Gene Name | GABARAP GABA(A) receptor-associated protein [ Homo sapiens ] |
| Official Symbol | GABARAP |
| Synonyms | GABARAP; GABA(A) receptor-associated protein; MM46; FLJ25768; MGC120154; MGC120155; Gamma-aminobutyric acid receptor-associated protein; FLC3B |
| Gene ID | 11337 |
| mRNA Refseq | NM_007278 |
| Protein Refseq | NP_009209 |
| MIM | 605125 |
| UniProt ID | O95166 |
| Chromosome Location | 17 |
| ◆ Recombinant Proteins | ||
| GABARAP-1786R | Recombinant Rhesus monkey GABARAP Protein, His-tagged | +Inquiry |
| GABARAP-4622H | Recombinant Human GABARAP Protein, GST-tagged | +Inquiry |
| GABARAP-581H | Active Recombinant Human GABARAP Protein, Agarose | +Inquiry |
| GABARAP-1010H | Recombinant Human GABA(A) Receptor-associated Protein | +Inquiry |
| GABARAP-580H | Active Recombinant Human GABARAP Protein, His-tagged Protein, Fluorescein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GABARAP Products
Required fields are marked with *
My Review for All GABARAP Products
Required fields are marked with *
