Recombinant Human GAL protein, His&Myc-tagged
Cat.No. : | GAL-4633H |
Product Overview : | Recombinant Human GAL protein(P22466)(44-123aa), fused with N-terminal His tag and C-terminal Myc tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&Myc |
Protein Length : | 44-123aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 16.4 kDa |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | GPHAVGNHRSFSDKNGLTSKRELRPEDDMKPGSFDRSIPENNIMRTIIEFLSFLHLKEAGALDRLLDLPAAASSEDIERS |
Gene Name | GAL galanin prepropeptide [ Homo sapiens ] |
Official Symbol | GAL |
Synonyms | GAL; galanin prepropeptide; galanin , GALN; galanin peptides; galanin message associated peptide; GLNN; GMAP; galanin-related peptide; galanin-message-associated peptide; GALN; MGC40167; |
Gene ID | 51083 |
mRNA Refseq | NM_015973 |
Protein Refseq | NP_057057 |
MIM | 137035 |
UniProt ID | P22466 |
◆ Recombinant Proteins | ||
GAL-2698H | Recombinant Human GAL protein(41-120 aa), C-His-tagged | +Inquiry |
GAL-301190H | Recombinant Human GAL protein, GST-tagged | +Inquiry |
GAL-2461R | Recombinant Rat GAL Protein | +Inquiry |
GAL-933H | Recombinant Human GAL Protein, MYC/DDK-tagged | +Inquiry |
GAL-3917C | Recombinant Chicken GAL | +Inquiry |
◆ Cell & Tissue Lysates | ||
GAL-759HCL | Recombinant Human GAL cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GAL Products
Required fields are marked with *
My Review for All GAL Products
Required fields are marked with *