Recombinant Human GAL protein, His&Myc-tagged
| Cat.No. : | GAL-4633H |
| Product Overview : | Recombinant Human GAL protein(P22466)(44-123aa), fused with N-terminal His tag and C-terminal Myc tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&Myc |
| Protein Length : | 44-123aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 16.4 kDa |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
| AA Sequence : | GPHAVGNHRSFSDKNGLTSKRELRPEDDMKPGSFDRSIPENNIMRTIIEFLSFLHLKEAGALDRLLDLPAAASSEDIERS |
| Gene Name | GAL galanin prepropeptide [ Homo sapiens ] |
| Official Symbol | GAL |
| Synonyms | GAL; galanin prepropeptide; galanin , GALN; galanin peptides; galanin message associated peptide; GLNN; GMAP; galanin-related peptide; galanin-message-associated peptide; GALN; MGC40167; |
| Gene ID | 51083 |
| mRNA Refseq | NM_015973 |
| Protein Refseq | NP_057057 |
| MIM | 137035 |
| UniProt ID | P22466 |
| ◆ Recombinant Proteins | ||
| GAL-3948C | Recombinant Chicken GAL | +Inquiry |
| GAL-3917C | Recombinant Chicken GAL | +Inquiry |
| GAL-933H | Recombinant Human GAL Protein, MYC/DDK-tagged | +Inquiry |
| GAL-4671H | Recombinant Human GAL Protein, GST-tagged | +Inquiry |
| GAL-4633H | Recombinant Human GAL protein, His&Myc-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| GAL-759HCL | Recombinant Human GAL cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GAL Products
Required fields are marked with *
My Review for All GAL Products
Required fields are marked with *
