Recombinant Human GARS1 protein(61-130 aa), C-His-tagged
| Cat.No. : | GARS1-2758H |
| Product Overview : | Recombinant Human GARS1 protein(P41250)(61-130 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 61-130 aa |
| Form : | 0.15 M Phosphate buffered saline |
| Molecular Mass : | 10.5 kDa |
| Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
| Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
| AA Sequence : | EEVLAPLRLAVRQQGDLVRKLKEDKAPQVDVDKAVAELKARKRVLEAKELALQPKDDIVDRAKMEDTLKR |
| ◆ Recombinant Proteins | ||
| GARS1-960H | Recombinant Human GARS1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| GARS1-2758H | Recombinant Human GARS1 protein(61-130 aa), C-His-tagged | +Inquiry |
| GARS1-3043H | Recombinant Human GARS1 Protein (Val567-Lys734), N-His tagged | +Inquiry |
| GARS1-1672HFL | Recombinant Full Length Human GARS1 Protein, C-Flag-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| GARS1-171HKCL | Human GARS1 Knockdown Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GARS1 Products
Required fields are marked with *
My Review for All GARS1 Products
Required fields are marked with *




