Recombinant Human GDF11 protein, His-SUMO-tagged
| Cat.No. : | GDF11-2952H |
| Product Overview : | Recombinant Human GDF11 protein(O95390)(299-407aa), fused to N-terminal His tag and SUMO tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&SUMO |
| Protein Length : | 299-407aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 28.5 kDa |
| AA Sequence : | NLGLDCDEHSSESRCCRYPLTVDFEAFGWDWIIAPKRYKANYCSGQCEYMFMQKYPHTHLVQQANPRGSAGPCCTPTKMSPINMLYFNDKQQIIYGKIPGMVVDRCGCS |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | GDF11 growth differentiation factor 11 [ Homo sapiens ] |
| Official Symbol | GDF11 |
| Synonyms | GDF11; growth differentiation factor 11; growth/differentiation factor 11; BMP 11; GDF-11; bone morphogenetic protein 11; BMP11; BMP-11; |
| Gene ID | 10220 |
| mRNA Refseq | NM_005811 |
| Protein Refseq | NP_005802 |
| MIM | 603936 |
| UniProt ID | O95390 |
| ◆ Recombinant Proteins | ||
| GDF11-6284M | Recombinant Mouse GDF11 Protein | +Inquiry |
| GDF11-07H | Active Recombinant Human GDF11 Protein (Asn299-Ser407), C-His tagged, Animal-free, Carrier-free | +Inquiry |
| GDF11-155H | Recombinant Human GDF11 Protein | +Inquiry |
| GDF11-103H | Recombinant Active Human GDF11 Protein, His-tagged(C-ter) | +Inquiry |
| GDF11-105H | Active Recombinant Human/Mouse/Rat GDF11 Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GDF11 Products
Required fields are marked with *
My Review for All GDF11 Products
Required fields are marked with *
