"GIPR" Related Products

Expand
Expand
Expand

Recombinant Human GIPR protein, His/SUMO-tagged

Cat.No.: GIPR-22H
Product Overview: Recombinant Human GIPR(aa 22-466) fused with His/SUMO tag was expressed in E. coli.
Description: This gene encodes a G-protein coupled receptor for gastric inhibitory polypeptide (GIP), which was originally identified as an activity in gut extracts that inhibited gastric acid secretion and gastrin release, but subsequently was demonstrated to stimulate insulin release in the presence of elevated glucose. Mice lacking this gene exhibit higher blood glucose levels with impaired initial insulin response after oral glucose load. Defect in this gene thus may contribute to the pathogenesis of diabetes.
Source: E. coli
Species: Human
Tag : His/SUMO
Form: Tris-based buffer,50% glycerol
Protein length: aa 22-466
AA Sequence: RAETGSKGQTAGELYQRWERYRRECQETLAAAEPPSGLACNGSFDMYVCWDYAAPNATAR ASCPWYLPWHHHVAAGFVLRQCGSDGQWGLWRDHTQCENPEKNEAFLDQRLILERLQVMY TVGYSLSLATLLLALLILSLFRRLHCTRNYIHINLFTSFMLRAAAILSRDRLLPRPGPYL GDQALALWNQALAACRTAQIVTQYCVGANYTWLLVEGVYLHSLLVLVGGSEEGHFRYYLL LGWGAPALFVIPWVIVRYLYENTQCWERNEVKAIWWIIRTPILMTILINFLIFIRILGIL LSKLRTRQMRCRDYRLRLARSTLTLVPLLGVHEVVFAPVTEEQARGALRFAKLGFEIFLS SFQGFLVSVLYCFINKEVQSEIRRGWHHCRLRRSLGEEQRQLPERAFRALPSGSGPGEVP TSRGLSSGTLPGPGNEASRELESYC
Stability: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage: Store at -20 centigrade, for extended storage, conserve at -20 centigrade or -80 centigrade.
Gene Name: GIPR gastric inhibitory polypeptide receptor [ Homo sapiens ]
Official Symbol: GIPR
Synonyms: GIPR; gastric inhibitory polypeptide receptor; GIP-R; glucose-dependent insulinotropic polypeptide receptor; PGQTL2; MGC126722;
Gene ID: 2696
mRNA Refseq: NM_000164
Protein Refseq: NP_000155
UniProt ID: P48546
Chromosome Location: 19q13.2-q13.3
Pathway: Class B/2 (Secretin family receptors), organism-specific biosystem; G alpha (s) signalling events, organism-specific biosystem; GPCR downstream signaling, organism-specific biosystem; GPCR ligand binding, organism-specific biosystem; GPCRs, Class B Secretin-like, organism-specific biosystem; Glucagon-type ligand receptors, organism-specific biosystem; Neuroactive ligand-receptor interaction, organism-specific biosystem;
Function: gastric inhibitory peptide receptor activity; peptide hormone binding; receptor activity; signal transducer activity; transmembrane signaling receptor activity;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.