Recombinant Human GJA5 protein, His-tagged

• Cat.No.: GJA5-3422H
• Product Overview: Recombinant Human GJA5 protein(P36382)(227-358aa), fused with C-terminal His tag, was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 227-358aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 21.6 kDa
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
• AA Sequence: YHLGWKKIRQRFVKPRQHMAKCQLSGPSVGIVQSCTPPPDFNQCLENGPGGKFFNPFSNNMASQQNTDNLVTEQVRGQEQTPGEGFIQVRYGQKPEVPNGVSPGHRLPHGYHSDKRRLSKASSKARSDDLSV

Gene Information

• Gene Name: GJA5 gap junction protein, alpha 5, 40kDa [ Homo sapiens ]
• Official Symbol: GJA5
• Synonyms: GJA5; gap junction protein, alpha 5, 40kDa; gap junction protein, alpha 5, 40kD (connexin 40) , gap junction protein, alpha 5, 40kDa (connexin 40); gap junction alpha-5 protein; connexin 40; CX40; connexin-40; ATFB11; MGC11185
• Gene ID: 2702
• mRNA Refseq: NM_005266
• Protein Refseq: NP_005257
• MIM: 121013
• UniProt ID: P36382