Recombinant Human GJA5 protein, His-tagged
| Cat.No. : | GJA5-3422H |
| Product Overview : | Recombinant Human GJA5 protein(P36382)(227-358aa), fused with C-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 227-358aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 21.6 kDa |
| Purity : | Greater than 85% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
| AA Sequence : | YHLGWKKIRQRFVKPRQHMAKCQLSGPSVGIVQSCTPPPDFNQCLENGPGGKFFNPFSNNMASQQNTDNLVTEQVRGQEQTPGEGFIQVRYGQKPEVPNGVSPGHRLPHGYHSDKRRLSKASSKARSDDLSV |
| Gene Name | GJA5 gap junction protein, alpha 5, 40kDa [ Homo sapiens ] |
| Official Symbol | GJA5 |
| Synonyms | GJA5; gap junction protein, alpha 5, 40kDa; gap junction protein, alpha 5, 40kD (connexin 40) , gap junction protein, alpha 5, 40kDa (connexin 40); gap junction alpha-5 protein; connexin 40; CX40; connexin-40; ATFB11; MGC11185; |
| Gene ID | 2702 |
| mRNA Refseq | NM_005266 |
| Protein Refseq | NP_005257 |
| MIM | 121013 |
| UniProt ID | P36382 |
| ◆ Recombinant Proteins | ||
| GJA5-3787H | Recombinant Human GJA5 protein, His-tagged | +Inquiry |
| Gja5-6995R | Recombinant Rat Gja5 protein, His-tagged | +Inquiry |
| GJA5-3343H | Recombinant Human GJA5 Protein (Tyr227-Val358), N-His tagged | +Inquiry |
| GJA5-7053C | Recombinant Chicken GJA5 | +Inquiry |
| GJA5-3422H | Recombinant Human GJA5 protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| GJA5-5920HCL | Recombinant Human GJA5 293 Cell Lysate | +Inquiry |
| GJA5-5921HCL | Recombinant Human GJA5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GJA5 Products
Required fields are marked with *
My Review for All GJA5 Products
Required fields are marked with *



