Recombinant Human GMFB Protein (142 aa)
Cat.No. : | GMFB-390G |
Product Overview : | Recombinant human Glia Maturation Factor beta (rhGMF-beta) produced in E. coli is a single non-glycosylated polypeptide chain containing 142 amino acids. rhGMF-beta has a molecular mass of 16.7kDa analyzed by reducing SDS-PAGE and is obtained by proprietary chromatographic techniques. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Protein Length : | 142 |
Description : | Glia Maturation Factor beta (GMF-beta) is a 17 kDa brain specific protein that belongs to the ADF/cofilin superfamily. It is a neurotrophin that induces maturation of neurons and glial cells. Unlike other neurotrophins, GMF-β lacks a leader sequence and can be phosphorylated by protein kinase A and protein kinase C suggesting its role in signal transduction. GMF-β is a prominent mediator of inflammation in the central nervous system and can activate several inflammation-related genes such as tumor necrosis factor-α and interleukin-1β. Researchers have shown there are significantly higher levels of GMF-β protein in all the effected regions of Alzheimer’s disease (AD) brains suggesting an important role of GMF-β in AD pathogenesis. |
Form : | Sterile Filtered White lyophilized (freeze-dried) powder. |
Bio-activity : | Bioassay data are not available. |
Molecular Mass : | 16.7 kDa, observed by reducing SDS-PAGE. |
AA Sequence : | MSESLVVCDVAEDLVEKLRKFRFRKETNNAAIIMKIDKDKRLVVLDEELEGISPDELKDELPERQPRFIVYSYKYQHDDGRVSYPLCFIFSSPVGCKPEQQMMYAGSKNKLVQTAELTKVFEIRNTEDLTEEWLREKLGFFH |
Endotoxin : | < 0.2 EU/μg, determined by LAL method. |
Purity : | > 95% by SDS-PAGE and HPLC analyses. |
Storage : | Lyophilized recombinant human Glia Maturation Factor beta (rhGMF-beta) remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, rhGMF-beta remains stable up to 2 weeks at 4 centigrade or up to 3 months at -20 centigrade. |
Storage Buffer : | Lyophilized after extensive dialysis against PBS. |
Reconstitution : | Reconstituted in ddH2O at 100 μg/mL. |
Gene Name | GMFB glia maturation factor, beta [ Homo sapiens ] |
Official Symbol | GMFB |
Synonyms | GMFB; glia maturation factor, beta; glia maturation factor beta; GMF; GMF-beta; |
Gene ID | 2764 |
mRNA Refseq | NM_004124 |
Protein Refseq | NP_004115 |
MIM | 601713 |
UniProt ID | P60983 |
◆ Recombinant Proteins | ||
GMFB-2877C | Recombinant Chicken GMFB | +Inquiry |
GMFB-994H | Recombinant Human GMFB Protein, His (Fc)-Avi-tagged | +Inquiry |
GMFB-390G | Recombinant Human GMFB Protein (142 aa) | +Inquiry |
GMFB-3247H | Recombinant Human GMFB Protein (Met1-His142), C-His tagged | +Inquiry |
GMFB-26568TH | Recombinant Human GMFB protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
GMFB-5883HCL | Recombinant Human GMFB 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GMFB Products
Required fields are marked with *
My Review for All GMFB Products
Required fields are marked with *
0
Inquiry Basket