| Species : |
Human |
| Source : |
E.coli |
| Protein Length : |
142 |
| Description : |
Glia Maturation Factor beta (GMF-beta) is a 17 kDa brain specific protein that belongs to the ADF/cofilin superfamily. It is a neurotrophin that induces maturation of neurons and glial cells. Unlike other neurotrophins, GMF-β lacks a leader sequence and can be phosphorylated by protein kinase A and protein kinase C suggesting its role in signal transduction. GMF-β is a prominent mediator of inflammation in the central nervous system and can activate several inflammation-related genes such as tumor necrosis factor-α and interleukin-1β. Researchers have shown there are significantly higher levels of GMF-β protein in all the effected regions of Alzheimer’s disease (AD) brains suggesting an important role of GMF-β in AD pathogenesis. |
| Form : |
Sterile Filtered White lyophilized (freeze-dried) powder. |
| Bio-activity : |
Bioassay data are not available. |
| Molecular Mass : |
16.7 kDa, observed by reducing SDS-PAGE. |
| AA Sequence : |
MSESLVVCDVAEDLVEKLRKFRFRKETNNAAIIMKIDKDKRLVVLDEELEGISPDELKDELPERQPRFIVYSYKYQHDDGRVSYPLCFIFSSPVGCKPEQQMMYAGSKNKLVQTAELTKVFEIRNTEDLTEEWLREKLGFFH |
| Endotoxin : |
< 0.2 EU/μg, determined by LAL method. |
| Purity : |
> 95% by SDS-PAGE and HPLC analyses. |
| Storage : |
Lyophilized recombinant human Glia Maturation Factor beta (rhGMF-beta) remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, rhGMF-beta remains stable up to 2 weeks at 4 centigrade or up to 3 months at -20 centigrade. |
| Storage Buffer : |
Lyophilized after extensive dialysis against PBS. |
| Reconstitution : |
Reconstituted in ddH2O at 100 μg/mL. |