Recombinant Human GNA11, GST-tagged
Cat.No. : | GNA11-22H |
Product Overview : | Recombinant Human GNA11(1 a.a. - 359 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The protein encoded by this gene belongs to the family of guanine nucleotide-binding proteins (G proteins), which function as modulators or transducers in various transmembrane signaling systems. G proteins are composed of 3 units: alpha, beta and gamma. This gene encodes one of the alpha subunits (subunit alpha-11). Mutations in this gene have been associated with hypocalciuric hypercalcemia type II (HHC2) and hypocalcemia dominant 2 (HYPOC2). Patients with HHC2 and HYPOC2 exhibit decreased or increased sensitivity, respectively, to changes in extracellular calcium concentrations. |
Molecular Mass : | 68.5 kDa |
AA Sequence : | MTLESMMACCLSDEVKESKRINAEIEKQLRRDKRDARRELKLLLLGTGESGKSTFIKQMRIIHGAGYSEEDKRGF TKLVYQNIFTAMQAMIRAMETLKILYKYEQNKANALLIREVDVEKVTTFEHQYVSAIKTLWEDPGIQECYDRRRE YQLSDSAKYYLTDVDRIATLGYLPTQQDVLRVRVPTTGIIEYPFDLENIIFRMVDVGGQRSERRKWIHCFENVTS IMFLVALSEYDQVLVESDNENRMEESKALFRTIITYPWFQNSSVILFLNKKDLLEDKILYSHLVDYFPEFDGPQR DAQAAREFILKMFVDLNPDSDKIIYSHFTCATDTENIRFVFAAVKDTILQLNLKEYNLV |
Applications : | ELISA; WB-Re; AP; Array |
Storage : | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | GNA11 guanine nucleotide binding protein (G protein), alpha 11 (Gq class) [ Homo sapiens (human) ] |
Official Symbol | GNA11 |
Synonyms | GNA11; FBH; FBH2; FHH2; HHC2; GNA-11; HYPOC2; guanine nucleotide binding protein (G protein), alpha 11 (Gq class); guanine nucleotide-binding protein subunit alpha-11; g alpha-11; G-protein subunit alpha-11; guanine nucleotide-binding protein G(y) subunit alpha |
Gene ID | 2767 |
mRNA Refseq | NM_002067 |
Protein Refseq | NP_002058 |
MIM | 139313 |
UniProt ID | P29992 |
Chromosome Location | 19p13.3 |
Pathway | ADP signalling through P2Y purinoceptor 1; Calcium Regulation in the Cardiac Cell; Cholinergic synapse |
Function | G-protein beta/gamma-subunit complex binding; G-protein coupled receptor binding; GTP binding |
◆ Recombinant Proteins | ||
GNA11-2590R | Recombinant Rat GNA11 Protein | +Inquiry |
GNA11-7009M | Recombinant Mouse GNA11 Protein | +Inquiry |
GNA11-5807C | Recombinant Chicken GNA11 | +Inquiry |
GNA11-1479HFL | Recombinant Full Length Human GNA11 Protein, C-Flag-tagged | +Inquiry |
GNA11-6939HF | Recombinant Full Length Human GNA11 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GNA11-5872HCL | Recombinant Human GNA11 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GNA11 Products
Required fields are marked with *
My Review for All GNA11 Products
Required fields are marked with *