Recombinant Human GNG12 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: GNG12-3810H
• Product Overview: GNG12 MS Standard C13 and N15-labeled recombinant protein (NP_061329) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: Guanine nucleotide-binding proteins (G proteins) are involved as a modulator or transducer in various transmembrane signaling systems. The beta and gamma chains are required for the GTPase activity, for replacement of GDP by GTP, and for G protein-effector interaction.
• Molecular Mass: 7.9 kDa
• AA Sequence: MSSKTASTNNIAQARRTVQQLRLEASIEGIKVSKASADLMSYCEEHARSDPLLIGIPTSENPFKDKKTCIILTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: GNG12 G protein subunit gamma 12 [ Homo sapiens (human) ]
• Official Symbol: GNG12
• Synonyms: GNG12; guanine nucleotide binding protein (G protein), gamma 12; guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-12; G-protein gamma-12 subunit; FLJ31352; FLJ34695
• Gene ID: 55970
• mRNA Refseq: NM_018841
• Protein Refseq: NP_061329
• MIM: 615405
• UniProt ID: Q9UBI6