Recombinant Human GNG12 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : GNG12-3810H
Product Overview : GNG12 MS Standard C13 and N15-labeled recombinant protein (NP_061329) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : Guanine nucleotide-binding proteins (G proteins) are involved as a modulator or transducer in various transmembrane signaling systems. The beta and gamma chains are required for the GTPase activity, for replacement of GDP by GTP, and for G protein-effector interaction.
Molecular Mass : 7.9 kDa
AA Sequence : MSSKTASTNNIAQARRTVQQLRLEASIEGIKVSKASADLMSYCEEHARSDPLLIGIPTSENPFKDKKTCIILTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name GNG12 G protein subunit gamma 12 [ Homo sapiens (human) ]
Official Symbol GNG12
Synonyms GNG12; guanine nucleotide binding protein (G protein), gamma 12; guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-12; G-protein gamma-12 subunit; FLJ31352; FLJ34695;
Gene ID 55970
mRNA Refseq NM_018841
Protein Refseq NP_061329
MIM 615405
UniProt ID Q9UBI6

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GNG12 Products

Required fields are marked with *

My Review for All GNG12 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon