Recombinant Human GNPNAT1 Protein, GST-tagged

• Cat.No.: GNPNAT1-5093H
• Product Overview: Human GNPNAT1 full-length ORF ( NP_932332.1, 1 a.a. - 184 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: GNPNAT1 (Glucosamine-Phosphate N-Acetyltransferase 1) is a Protein Coding gene. Among its related pathways are Amino sugar and nucleotide sugar metabolism and Synthesis of substrates in N-glycan biosythesis. GO annotations related to this gene include identical protein binding and monosaccharide binding.
• Molecular Mass: 47.1 kDa
• AA Sequence: MKPDETPMFDPSLLKEVDWSQNTATFSPAISPTHPGEGLVLRPLCTADLNRGFFKVLGQLTETGVVSPEQFMKSFEHMKKSGDYYVTVVEDVTLGQIVATATLIIEHKFIHSCAKRGRVEDVVVSDECRGKQLGKLLLSTLTLLSKKLNCYKITLECLPQNVGFYKKFGYTVSEENYMCRRFLK
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: GNPNAT1 glucosamine-phosphate N-acetyltransferase 1 [ Homo sapiens ]
• Official Symbol: GNPNAT1
• Synonyms: GNPNAT1; glucosamine-phosphate N-acetyltransferase 1; glucosamine 6-phosphate N-acetyltransferase; FLJ10607; Gpnat1; phosphoglucosamine acetylase; phosphoglucosamine transacetylase; GNPNAT
• Gene ID: 64841
• mRNA Refseq: NM_198066
• Protein Refseq: NP_932332
• MIM: 616510
• UniProt ID: Q96EK6