Recombinant Human GNPNAT1 Protein, GST-tagged

Cat.No. : GNPNAT1-5093H
Product Overview : Human GNPNAT1 full-length ORF ( NP_932332.1, 1 a.a. - 184 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : GNPNAT1 (Glucosamine-Phosphate N-Acetyltransferase 1) is a Protein Coding gene. Among its related pathways are Amino sugar and nucleotide sugar metabolism and Synthesis of substrates in N-glycan biosythesis. GO annotations related to this gene include identical protein binding and monosaccharide binding.
Molecular Mass : 47.1 kDa
AA Sequence : MKPDETPMFDPSLLKEVDWSQNTATFSPAISPTHPGEGLVLRPLCTADLNRGFFKVLGQLTETGVVSPEQFMKSFEHMKKSGDYYVTVVEDVTLGQIVATATLIIEHKFIHSCAKRGRVEDVVVSDECRGKQLGKLLLSTLTLLSKKLNCYKITLECLPQNVGFYKKFGYTVSEENYMCRRFLK
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name GNPNAT1 glucosamine-phosphate N-acetyltransferase 1 [ Homo sapiens ]
Official Symbol GNPNAT1
Synonyms GNPNAT1; glucosamine-phosphate N-acetyltransferase 1; glucosamine 6-phosphate N-acetyltransferase; FLJ10607; Gpnat1; phosphoglucosamine acetylase; phosphoglucosamine transacetylase; GNPNAT;
Gene ID 64841
mRNA Refseq NM_198066
Protein Refseq NP_932332
MIM 616510
UniProt ID Q96EK6

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GNPNAT1 Products

Required fields are marked with *

My Review for All GNPNAT1 Products

Required fields are marked with *

0
cart-icon