Recombinant Human GPX2 Protein, His-tagged

Cat.No. : GPX2-5309H
Product Overview : Human GPX2 (NP_002074, 1 a.a. - 190 a.a.) full-length recombinant protein with His tag expressed in Escherichia coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Description : This gene is a member of the glutathione peroxidase family and encodes a selenium-dependent glutathione peroxidase that is one of two isoenzymes responsible for the majority of the glutathione-dependent hydrogen peroxide-reducing activity in the epithelium of the gastrointestinal tract. Studies in knockout mice indicate that mRNA expression levels respond to luminal microflora, suggesting a role of the ileal glutathione peroxidases in preventing inflammation in the GI tract. [provided by RefSeq
Form : Liquid
Molecular Mass : 24.1 kDa
AA Sequence : MGSSHHHHHHSSGLVPRGSHMAFIAKSFYDLSAISLDGEKVDFNTFRGRAVLIENVASLCGTTTRDFTQLNELQCRFPRRLVVLGFPCNQFGHQENCQNEEILNSLKYVRPGGGYQPTFTLVQKCEVNGQNEHPVFAYLKDKLPYPYDDPFSLMTDPKLIIWSPVRRSDVAWNFEKFLIGPEGEPFRRYSRTFPTINIEPDIKRLLKVAI
Purity : > 95% by SDS-PAGE
Applications : Functional Study
SDS-PAGE
Storage : Store at 4 centigrade for 1-2 weeks. For long term storage store at -20 centigrade or -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Concentration : 0.25 mg/mL
Storage Buffer : In 20 mM Tris-HCl, 0.15 M NaCl, pH7.5. (40% glycerol, 1 mM DTT)
Gene Name GPX2 glutathione peroxidase 2 (gastrointestinal) [ Homo sapiens ]
Official Symbol GPX2
Synonyms GPX2; glutathione peroxidase 2 (gastrointestinal); glutathione peroxidase 2; GSHPX GI; glutathione peroxidase-gastrointestinal; glutathione peroxidase-related protein 2; gastrointestinal glutathione peroxidase 2; GPRP; GPx-2; GI-GPx; GPRP-2; GPx-GI; GSHPx-2; GSHPX-GI;
Gene ID 2877
mRNA Refseq NM_002083
Protein Refseq NP_002074
MIM 138319
UniProt ID P18283

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GPX2 Products

Required fields are marked with *

My Review for All GPX2 Products

Required fields are marked with *

0
cart-icon