Recombinant Human GPX2 Protein, His-tagged
Cat.No. : | GPX2-5309H |
Product Overview : | Human GPX2 (NP_002074, 1 a.a. - 190 a.a.) full-length recombinant protein with His tag expressed in Escherichia coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Description : | This gene is a member of the glutathione peroxidase family and encodes a selenium-dependent glutathione peroxidase that is one of two isoenzymes responsible for the majority of the glutathione-dependent hydrogen peroxide-reducing activity in the epithelium of the gastrointestinal tract. Studies in knockout mice indicate that mRNA expression levels respond to luminal microflora, suggesting a role of the ileal glutathione peroxidases in preventing inflammation in the GI tract. [provided by RefSeq |
Form : | Liquid |
Molecular Mass : | 24.1 kDa |
AA Sequence : | MGSSHHHHHHSSGLVPRGSHMAFIAKSFYDLSAISLDGEKVDFNTFRGRAVLIENVASLCGTTTRDFTQLNELQCRFPRRLVVLGFPCNQFGHQENCQNEEILNSLKYVRPGGGYQPTFTLVQKCEVNGQNEHPVFAYLKDKLPYPYDDPFSLMTDPKLIIWSPVRRSDVAWNFEKFLIGPEGEPFRRYSRTFPTINIEPDIKRLLKVAI |
Purity : | > 95% by SDS-PAGE |
Applications : | Functional Study SDS-PAGE |
Storage : | Store at 4 centigrade for 1-2 weeks. For long term storage store at -20 centigrade or -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Concentration : | 0.25 mg/mL |
Storage Buffer : | In 20 mM Tris-HCl, 0.15 M NaCl, pH7.5. (40% glycerol, 1 mM DTT) |
Gene Name | GPX2 glutathione peroxidase 2 (gastrointestinal) [ Homo sapiens ] |
Official Symbol | GPX2 |
Synonyms | GPX2; glutathione peroxidase 2 (gastrointestinal); glutathione peroxidase 2; GSHPX GI; glutathione peroxidase-gastrointestinal; glutathione peroxidase-related protein 2; gastrointestinal glutathione peroxidase 2; GPRP; GPx-2; GI-GPx; GPRP-2; GPx-GI; GSHPx-2; GSHPX-GI; |
Gene ID | 2877 |
mRNA Refseq | NM_002083 |
Protein Refseq | NP_002074 |
MIM | 138319 |
UniProt ID | P18283 |
◆ Recombinant Proteins | ||
GPX2-19H | Recombinant Human GPX2 Protein, 190 residues | +Inquiry |
GPX2-1170B | Recombinant Baker's yeast GPX2 protein, His&Myc-tagged | +Inquiry |
GPX2-29071TH | Recombinant Human GPX2, His-tagged | +Inquiry |
GPX2-5203C | Recombinant Chicken GPX2 | +Inquiry |
GPX2-1164B | Recombinant Baker's yeast GPX2 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GPX2-5762HCL | Recombinant Human GPX2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GPX2 Products
Required fields are marked with *
My Review for All GPX2 Products
Required fields are marked with *