Recombinant Human GPX8, His-tagged
| Cat.No. : | GPX8-96H |
| Product Overview : | Recombinant Human Probable Glutathione Peroxidase 8/GPX8 is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Met1-Leu209) of Human GPX8 fused with a polyhistidine tag at the C-terminus. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | His |
| Protein Length : | 1-209 a.a. |
| Description : | Probable Glutathione Peroxidase 8 (GPX8) is a member of the glutathione peroxidase family. GPX8 is a single-pass membrane protein and catalysis glutathione into glutathione disulfide. It is shown that GPX8 interacts with 17alpha-ethynylestradiol, diuron and 2-butoxyethanol (ortholog). In addition, GPX8 is involved in response to oxidative stress. |
| AA Sequence : | MEPLAAYPLKCSGPRAKVFAVLLSIVLCTVTLFLLQLKFLKPKINSFYAFEVKDAKGRTV SLEK YKGKVSLVVNVASDCQLTDRNYLGLKELHKEFGPSHFSVLAFPCNQFGESEPRPSK EVESFARK NYGVTFPIFHKIKILGSEGEPAFRFLVDSSKKEPRWNFWKYLVNPEGQVVKF WKPEEPIEVIRP DIAALVRQVIIKKKEDLVDHHHHHH |
| Endotoxin : | Less than 0.1 ng/μg (1 IEU/μg). |
| Purity : | Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
| Gene Name | GPX8 glutathione peroxidase 8 (putative) [ Homo sapiens ] |
| Official Symbol | GPX8 |
| Synonyms | GPX8; glutathione peroxidase 8 (putative); probable glutathione peroxidase 8; EPLA847; UNQ847; GPx-8; GSHPx-8; |
| Gene ID | 493869 |
| mRNA Refseq | NM_001008397 |
| Protein Refseq | NP_001008398 |
| UniProt ID | Q8TED1 |
| Chromosome Location | 5q11.2 |
| Pathway | glutathione redox reactions I, organism-specific biosystem; |
| Function | glutathione peroxidase activity; oxidoreductase activity; |
| ◆ Recombinant Proteins | ||
| RFL12243MF | Recombinant Full Length Mouse Probable Glutathione Peroxidase 8(Gpx8) Protein, His-Tagged | +Inquiry |
| RFL13796TF | Recombinant Full Length Tetraodon Nigroviridis Probable Glutathione Peroxidase 8(Gpx8) Protein, His-Tagged | +Inquiry |
| GPX8-7236M | Recombinant Mouse GPX8 Protein | +Inquiry |
| GPX8-10562Z | Recombinant Zebrafish GPX8 | +Inquiry |
| GPX8-5589HF | Recombinant Full Length Human GPX8 Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| GPX8-5761HCL | Recombinant Human GPX8 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GPX8 Products
Required fields are marked with *
My Review for All GPX8 Products
Required fields are marked with *
