Recombinant Human GRB14 protein, His-tagged
Cat.No. : | GRB14-13519H |
Product Overview : | Recombinant Human GRB14 protein(225-540 aa), fused with N-terminal His tag, was expressed in E.coli. |
Availability | September 08, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 225-540 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole. |
AASequence : | LQMFLSSSTYPEIHGFLHAKEQGKKSWKKIYFFLRRSGLYFSTKGTSKEPRHLQFFSEFGNSDIYVSLAGKKKHGAPTNYGFCFKPNKAGGPRDLKMLCAEEEQSRTCWVTAIRLLKYGMQLYQNYMHPYQGRSGCSSQSISPMRSISENSLVAMDFSGQKSRVIENPTEALSVAVEEGLAWRKKGCLRLGTHGSPTASSQSSATNMAIHRSQPWFHHKISRDEAQRLIIQQGLVDGVFLVRDSQSNPKTFVLSMSHGQKIKHFQIIPVEDDGEMFHTLDDGHTRFTDLIQLVEFYQLNKGVLPCKLKHYCARIAL |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
Gene Name | GRB14 growth factor receptor-bound protein 14 [ Homo sapiens ] |
Official Symbol | GRB14 |
Synonyms | GRB14; growth factor receptor-bound protein 14; GRB14 adapter protein; |
Gene ID | 2888 |
mRNA Refseq | NM_004490 |
Protein Refseq | NP_004481 |
MIM | 601524 |
UniProt ID | Q14449 |
◆ Recombinant Proteins | ||
GRB14-5405H | Recombinant Human GRB14 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
GRB14-2685R | Recombinant Rat GRB14 Protein | +Inquiry |
Grb14-3303M | Recombinant Mouse Grb14 Protein, Myc/DDK-tagged | +Inquiry |
GRB14-5037H | Recombinant Human GRB14 Protein, GST-tagged | +Inquiry |
GRB14-538H | Recombinant Human GRB14 Protein, MYC/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GRB14-5756HCL | Recombinant Human GRB14 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GRB14 Products
Required fields are marked with *
My Review for All GRB14 Products
Required fields are marked with *