Recombinant Human GRIA1 protein, His-tagged
| Cat.No. : | GRIA1-2701H |
| Product Overview : | Recombinant Human GRIA1 protein(88-287 aa), fused with N-terminal His tag, was expressed in E. coli. |
| Availability | November 09, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 88-287 aa |
| Tag : | N-His |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
| Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
| AA Sequence : | FYERRTVNMLTSFCGALHVCFITPSFPVDTSNQFVLQLRPELQDALISIIDHYKWQKFVYIYDADRGLSVLQKVLDTAAEKNWQVTAVNILTTTEEGYRMLFQDLEKKKERLVVVDCESERLNAILGQIIKLEKNGIGYHYILANLGFMDIDLNKFKESGANVTGFQLVNYTDTIPAKIMQQWKNSDARDHTRVDWKRPK |
| Gene Name | GRIA1 glutamate receptor, ionotropic, AMPA 1 [ Homo sapiens ] |
| Official Symbol | GRIA1 |
| Synonyms | GRIA1; glutamate receptor, ionotropic, AMPA 1; GLUR1; glutamate receptor 1; GluA1; GLURA; AMPA 1; gluR-1; gluR-A; gluR-K1; AMPA-selective glutamate receptor 1; GLUH1; HBGR1; MGC133252; |
| Gene ID | 2890 |
| mRNA Refseq | NM_000827 |
| Protein Refseq | NP_000818 |
| MIM | 138248 |
| UniProt ID | P42261 |
| ◆ Recombinant Proteins | ||
| Gria1-1062M | Recombinant Mouse Gria1 Protein, MYC/DDK-tagged | +Inquiry |
| Gria1-1587R | Recombinant Rat Gria1 Protein, His&GST-tagged | +Inquiry |
| GRIA1-1165C | Recombinant Chicken GRIA1 | +Inquiry |
| GRIA1-29069TH | Recombinant Human GRIA1 | +Inquiry |
| GRIA1-2641H | Recombinant Human GRIA1 protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| GRIA1-5748HCL | Recombinant Human GRIA1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GRIA1 Products
Required fields are marked with *
My Review for All GRIA1 Products
Required fields are marked with *
