Recombinant Human GRM8 Protein, GST-tagged

Cat.No. : GRM8-5374H
Product Overview : Human GRM8 partial ORF ( NP_000836, 486 a.a. - 575 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : L-glutamate is the major excitatory neurotransmitter in the central nervous system and activates both ionotropic and metabotropic glutamate receptors. Glutamatergic neurotransmission is involved in most aspects of normal brain function and can be perturbed in many neuropathologic conditions. The metabotropic glutamate receptors are a family of G protein-coupled receptors, that have been divided into 3 groups on the basis of sequence homology, putative signal transduction mechanisms, and pharmacologic properties. Group I includes GRM1 and GRM5 and these receptors have been shown to activate phospholipase C. Group II includes GRM2 and GRM3 while Group III includes GRM4, GRM6, GRM7 and GRM8. Group II and III receptors are linked to the inhibition of the cyclic AMP cascade but differ in their agonist selectivities. Alternatively spliced transcript variants encoding different isoforms have been described for this gene. [provided by RefSeq
Molecular Mass : 35.64 kDa
AA Sequence : KVIGHWTNQLHLKVEDMQWAHREHTHPASVCSLPCKPGERKKTVKGVPCCWHCERCEGYNYQVDELSCELCPLDQRPNMNRTGCQLIPII
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name GRM8 glutamate receptor, metabotropic 8 [ Homo sapiens ]
Official Symbol GRM8
Synonyms GRM8; glutamate receptor, metabotropic 8; metabotropic glutamate receptor 8; GLUR8; GPRC1H; mGlu8; MGLUR8; FLJ41058; MGC126724;
Gene ID 2918
mRNA Refseq NM_000845
Protein Refseq NP_000836
MIM 601116
UniProt ID O00222

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GRM8 Products

Required fields are marked with *

My Review for All GRM8 Products

Required fields are marked with *

0
cart-icon
0
compare icon