Recombinant Human GRN Protein, GST-tagged
Cat.No. : | GRN-5375H |
Product Overview : | Human GRN full-length ORF ( NP_002078.1, 1 a.a. - 593 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | Granulins are a family of secreted, glycosylated peptides that are cleaved from a single precursor protein with 7.5 repeats of a highly conserved 12-cysteine granulin/epithelin motif. The 88 kDa precursor protein, progranulin, is also called proepithelin and PC cell-derived growth factor. Cleavage of the signal peptide produces mature granulin which can be further cleaved into a variety of active, 6 kDa peptides. These smaller cleavage products are named granulin A, granulin B, granulin C, etc. Epithelins 1 and 2 are synonymous with granulins A and B, respectively. Both the peptides and intact granulin protein regulate cell growth. However, different members of the granulin protein family may act as inhibitors, stimulators, or have dual actions on cell growth. Granulin family members are important in normal development, wound healing, and tumorigenesis. [provided by RefSeq |
Molecular Mass : | 89.9 kDa |
AA Sequence : | MWTLVSWVALTAGLVAGTRCPDGQFCPVACCLDPGGASYSCCRPLLDKWPTTLSRHLGGPCQVDAHCSAGHSCIFTVSGTSSCCPFPEAVACGDGHHCCPRGFHCSADGRSCFQRSGNNSVGAIQCPDSQFECPDFSTCCVMVDGSWGCCPMPQASCCEDRVHCCPHGAFCDLVHTRCITPTGTHPLAKKLPAQRTNRAVALSSSVMCPDARSRCPDGSTCCELPSGKYGCCPMPNATCCSDHLHCCPQDTVCDLIQSKCLSKENATTDLLTKLPAHTVGDVKCDMEVSCPDGYTCCRLQSGAWGCCPFTQAVCCEDHIHCCPAGFTCDTQKGTCEQGPHQVPWMEKAPAHLSLPDPQALKRDVPCDNVSSCPSSDTCCQLTSGEWGCCPIPEAVCCSDHQHCCPQGYTCVAEGQCQRGSEIVAGLEKMPARRASLSHPRDIGCDQHTSCPVGQTCCPSLGGSWACCQLPHAVCCEDRQHCCPAGYTCNVKARSCEKEVVSAQPATFLARSPHVGVKDVECGEGHFCHDNQTCCRDNRQGWACCPYRQGVCCADRRHCCPAGFRCAARGTKCLRREAPRWDAPLRDPALRQLL |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | GRN granulin [ Homo sapiens ] |
Official Symbol | GRN |
Synonyms | GRN; granulin; granulins; CLN11; PCDGF; PGRN; progranulin; acrogranin; proepithelin; granulin-epithelin; PC cell-derived growth factor; GEP; GP88; PEPI; |
Gene ID | 2896 |
mRNA Refseq | NM_002087 |
Protein Refseq | NP_002078 |
MIM | 138945 |
UniProt ID | P28799 |
◆ Recombinant Proteins | ||
GRN-28163TH | Recombinant Human GRN, FLAG-tagged | +Inquiry |
Grn-7848M | Recombinant Mouse Grn protein, His & T7-tagged | +Inquiry |
GRN-041H | Recombinant Human GRN Protein, MYC/DDK-tagged, C13 and N15-labeled | +Inquiry |
Grn-467M | Recombinant Mouse Grn | +Inquiry |
GRN-2358H | Recombinant Human GRN Protein, MYC/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GRN-2412MCL | Recombinant Mouse GRN cell lysate | +Inquiry |
GRN-2791HCL | Recombinant Human GRN cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GRN Products
Required fields are marked with *
My Review for All GRN Products
Required fields are marked with *
0
Inquiry Basket