Recombinant Human GSK3A Protein, GST-tagged
Cat.No. : | GSK3A-4397H |
Product Overview : | Human GSK3A full-length ORF (AAH27984.1, 1 a.a. - 483 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | Glycogen synthase kinase 3-alpha (GSK3A; EC {2.7.1.37}) is a multifunctional protein serine kinase, homologous to Drosophila shaggy (zeste-white3) and implicated in the control of several regulatory proteins including glycogen synthase (see GYS1, {138570}) and transcription factors (e.g., JUN, {165160}). It also plays a role in the WNT ({164820}) and PI3K (see PIK3CG, {601232}) signaling pathways (see review by {1:Ali et al. (2001)}).[supplied by OMIM |
Molecular Mass : | 77.4 kDa |
AA Sequence : | MSGGGPSGGGPGGSGRARTSSFAEPGGGGGGGGGGPGGSASGPGGTGGGKASVGAMGGGVGASSSGGGPGGSGGGGSGGPGAGTSFPPPGVKLGRDSGKVTTVVATLGQGPERSQEVAYTDIKVIGNGSFGVVYQARLAETRELVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSGEKKDELYLNLVLEYVPETVYRVARHFTKAKLTIPILYVKVYMYQLFRSLAYIHSQGVCHRDIKPQNLLVDPDTAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSSIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPNYTEFKFPQIKAHPWTKVFKSRTPPEAIALCSSLLEYTPSSRLSPLEACAHSFFDELRCLGTQLPNNRPLPPLFNFSAGELSIQPSLNAILIPPHLRSPAGTTTLTPSSQALTETPTSSDWQSTDATPTLTNSS |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | GSK3A glycogen synthase kinase 3 alpha [ Homo sapiens ] |
Official Symbol | GSK3A |
Synonyms | GSK3A; glycogen synthase kinase 3 alpha; glycogen synthase kinase-3 alpha; GSK-3 alpha; serine/threonine-protein kinase GSK3A; DKFZp686D0638; |
Gene ID | 2931 |
mRNA Refseq | NM_019884 |
Protein Refseq | NP_063937 |
MIM | 606784 |
UniProt ID | P49840 |
◆ Recombinant Proteins | ||
GSK3A-156HFL | Active Recombinant Full Length Human GSK3A Protein, C-Flag-tagged | +Inquiry |
GSK3A-1026H | Recombinant Human GSK3A Protein, His (Fc)-Avi-tagged | +Inquiry |
Gsk3a-3317M | Recombinant Mouse Gsk3a Protein, Myc/DDK-tagged | +Inquiry |
GSK3A-1805R | Recombinant Rhesus Macaque GSK3A Protein, His (Fc)-Avi-tagged | +Inquiry |
GSK3A-1133H | Recombinant Human Glycogen Synthase Kinase 3 Alpha | +Inquiry |
◆ Cell & Tissue Lysates | ||
GSK3A-5723HCL | Recombinant Human GSK3A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GSK3A Products
Required fields are marked with *
My Review for All GSK3A Products
Required fields are marked with *