Recombinant Human GSK3B protein, His-tagged
Cat.No. : | GSK3B-7854H |
Product Overview : | Recombinant Human GSK3B protein(1-351 aa), fused with N-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-351 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. |
AASequence : | MSGRPRTTSFAESCKPVQQPSAFGSMKVSRDKDGSKVTTVVATPGQGPDRPQEVSYTDTKVIGNGSFGVVYQAKLCDSGELVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSGEKKDEVYLNLVLDYVPETVYRVARHYSRAKQTLPVIYVKLYMYQLFRSLAYIHSFGICHRDIKPQNLLLDPDTAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSSIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPNYTEFKFPQIKAHPWTKDSSGTGHFTSGVRVFRPRTPPEAIALCSRLLEYTPTARLTPLEACAHS |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
Gene Name | GSK3B glycogen synthase kinase 3 beta [ Homo sapiens ] |
Official Symbol | GSK3B |
Synonyms | GSK3B; glycogen synthase kinase 3 beta; glycogen synthase kinase-3 beta; GSK-3 beta; GSK3beta isoform; serine/threonine-protein kinase GSK3B; |
Gene ID | 2932 |
mRNA Refseq | NM_001146156 |
Protein Refseq | NP_001139628 |
MIM | 605004 |
UniProt ID | P49841 |
◆ Recombinant Proteins | ||
GSK3B-2997H | Recombinant Human GSK3B protein, His-tagged | +Inquiry |
GSK3B-2350H | Recombinant Human GSK3B Protein, MYC/DDK-tagged | +Inquiry |
GSK3B-6642HF | Active Recombinant Full Length Human GSK3B Protein, GST-tagged | +Inquiry |
GSK3B-2799H | Recombinant Human GSK3B Protein (Met1-Thr420), N-GST tagged | +Inquiry |
GSK3B-1027H | Recombinant Human GSK3B Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GSK3B-534MCL | Recombinant Mouse GSK3B cell lysate | +Inquiry |
GSK3B-717HCL | Recombinant Human GSK3B cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GSK3B Products
Required fields are marked with *
My Review for All GSK3B Products
Required fields are marked with *