Recombinant Human GSK3B protein, His-tagged
| Cat.No. : | GSK3B-7855H |
| Product Overview : | Recombinant Human GSK3B protein(358-433 aa), fused with N-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 358-433 aa |
| Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. |
| AASequence : | DPNVKLPNGRDTPALFNFTTQELSSNPPLATILIPPHARIQAAASTPTNATAASDANTGDRGQTNNAASASASNST |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
| Gene Name | GSK3B glycogen synthase kinase 3 beta [ Homo sapiens ] |
| Official Symbol | GSK3B |
| Synonyms | GSK3B; glycogen synthase kinase 3 beta; glycogen synthase kinase-3 beta; GSK-3 beta; GSK3beta isoform; serine/threonine-protein kinase GSK3B; |
| Gene ID | 2932 |
| mRNA Refseq | NM_001146156 |
| Protein Refseq | NP_001139628 |
| MIM | 605004 |
| UniProt ID | P49841 |
| ◆ Recombinant Proteins | ||
| GSK3B-416H | Recombinant Human GSK3B protein, His-tagged | +Inquiry |
| GSK3B-406H | Recombinant Human glycogen synthase kinase 3 beta, His-tagged | +Inquiry |
| GSK3B-28630TH | Recombinant Human GSK3B | +Inquiry |
| GSK3B-326H | Active Recombinant Human GSK3B protein, GST-tagged | +Inquiry |
| GSK3B-2649H | Recombinant Human Glycogen Synthase Kinase 3 Beta, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| GSK3B-534MCL | Recombinant Mouse GSK3B cell lysate | +Inquiry |
| GSK3B-717HCL | Recombinant Human GSK3B cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GSK3B Products
Required fields are marked with *
My Review for All GSK3B Products
Required fields are marked with *




