Recombinant Human GSK3B protein, His-tagged
| Cat.No. : | GSK3B-416H |
| Product Overview : | Recombinant Human GSK3B protein(NP_001139628)(355-433 aa), fused to His tag, was expressed in E. coli. |
| Availability | December 31, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 355-433 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.). 5 % trehalose and 5 % mannitol are added as protectants before lyophilization. |
| AA Sequence : | ELRDPNVKLPNGRDTPALFNFTTQELSSNPPLATILIPPHARIQAAASTPTNATAASDANTGDRGQTNNAASASASNST |
| Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage (see Stability and Storage for more details). If a different concentration is needed for your purposes please adjust the reconstitution volume as required (please note: the ion concentration of the final solution will vary according to the volume used). Note: Centrifuge vial before opening. When reconstituting, gently pipet and wash down the sides of the vial to ensure full recovery of the protein into solution. |
| Gene Name | GSK3B glycogen synthase kinase 3 beta [ Homo sapiens ] |
| Official Symbol | GSK3B |
| Synonyms | GSK3B; glycogen synthase kinase 3 beta; glycogen synthase kinase-3 beta; GSK-3 beta; GSK3beta isoform; serine/threonine-protein kinase GSK3B; |
| Gene ID | 2932 |
| mRNA Refseq | NM_001146156 |
| Protein Refseq | NP_001139628 |
| MIM | 605004 |
| UniProt ID | P49841 |
| ◆ Recombinant Proteins | ||
| GSK3B-430HFL | Recombinant Full Length Human GSK3B Protein, C-Flag-tagged | +Inquiry |
| Gsk3b-1603R | Recombinant Rat Gsk3b Protein, His-tagged | +Inquiry |
| GSK3B-2129H | Recombinant Human GSK3B Protein (1-420 aa), His-tagged | +Inquiry |
| GSK3B-2649H | Recombinant Human Glycogen Synthase Kinase 3 Beta, His-tagged | +Inquiry |
| GSK3B-2728R | Recombinant Rat GSK3B Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| GSK3B-717HCL | Recombinant Human GSK3B cell lysate | +Inquiry |
| GSK3B-534MCL | Recombinant Mouse GSK3B cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GSK3B Products
Required fields are marked with *
My Review for All GSK3B Products
Required fields are marked with *
