Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at IMMUNOLOGY2024™|May 3-7, 2024|Booth #512

Recombinant Human GTF2I

Cat.No. : GTF2I-29513TH
Product Overview : Recombinant fragment of Human TFII I, aa 36-274 according to AAH04472.1, with N terminal proprietary tag, MW: 52.4 kDa inclusive of tag.
  • Specification
  • Gene Information
  • Related Products
Description : This gene encodes a multifunctional phosphoprotein with roles in transcription and signal transduction. It is deleted in Williams-Beuren syndrome, a multisystem developmental disorder caused by the deletion of contiguous genes at chromosome 7q11.23. Alternative splicing results in multiple transcript variants. Related pseudogenes have been identified on chromosomes 7, 13 and 21.
Protein length : 239 amino acids
Molecular Weight : 52.400kDa inclusive of tags
Source : Wheat germ
Tissue specificity : Ubiquitous. Isoform 1 is strongly expressed in fetal brain, weakly in adult brain, muscle, and lymphoblasts and is almost undetectable in other adult tissues, while the other isoforms are equally expressed in all adult tissues.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : ELAKSKAEVACIAVYETDVFVVGTERGRAFVNTRKDFQKD FVKYCVEEEEKAAEMHKMKSTTQANRMSVDAVEIETLRKT VEDYFCFCYGKALGKSTVVPVPYEKMLRDQSAVVVQGLPE GVAFKHPENYDLATLKWILENKAGISFIIKRPFLEPKKHV GGRVMVTDADRSILSPGGSCGPIKVKTEPTEDSGISLEMA AVTVKEESEDPDYYQYNIQGSHHSSEGNEGTEMEVPAEG
Sequence Similarities : Belongs to the TFII-I family.Contains 6 GTF2I-like repeats.
Gene Name : GTF2I general transcription factor IIi [ Homo sapiens ]
Official Symbol : GTF2I
Synonyms : GTF2I; general transcription factor IIi; general transcription factor II, i , WBSCR6; general transcription factor II-I; BAP 135; BTKAP1; DIWS; IB291; SPIN; TFII I;
Gene ID : 2969
mRNA Refseq : NM_001163636
Protein Refseq : NP_001157108
MIM : 601679
Uniprot ID : P78347
Chromosome Location : 7q11.23
Pathway : B Cell Receptor Signaling Pathway, organism-specific biosystem; Basal transcription factors, organism-specific biosystem; Basal transcription factors, conserved biosystem; Herpes simplex infection, organism-specific biosystem; Herpes simplex infection, conserved biosystem;
Function : DNA binding; mitogen-activated protein kinase binding; protein binding; sequence-specific DNA binding transcription factor activity;

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

0

Inquiry Basket

cartIcon
logo

FOLLOW US

Terms and Conditions        Privacy Policy

Copyright © 2024 Creative BioMart. All Rights Reserved.

Contact Us

  • /

Stay Updated on the Latest Bioscience Trends