Recombinant Human GUCY2F Protein, GST-tagged

Cat.No. : GUCY2F-4494H
Product Overview : Human GUCY2F partial ORF ( NP_001513, 311 a.a. - 420 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : The protein encoded by this gene is a guanylyl cyclase found predominantly in photoreceptors in the retina. The encoded protein is thought to be involved in resynthesis of cGMP after light activation of the visual signal transduction cascade, allowing a return to the dark state. This protein is a single-pass type I membrane protein. Defects in this gene may be a cause of X-linked retinitis pigmentosa. [provided by RefSeq
Molecular Mass : 37.73 kDa
AA Sequence : VLTITVESQEKTFYQAFTEAAARGEIPEKLEFDQVSPLFGTIYNSIYFIAQAMNNAMKENGQAGAASLVQHSRNMQFHGFNQLMRTDSNGNGISEYVILDTNLKEWELHS
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name GUCY2F guanylate cyclase 2F, retinal [ Homo sapiens ]
Official Symbol GUCY2F
Synonyms GUCY2F; guanylate cyclase 2F, retinal; retinal guanylyl cyclase 2; CYGF; GC F; guanylate cyclase 2D like; membrane (retina specific); GUC2DL; RetGC 2; ROS GC2; guanylate cyclase F; rod outer segment membrane guanylate cyclase 2; guanylate cyclase 2D-like, membrane (retina-specific); GC-F; GUC2F; RETGC-2; ROS-GC2;
Gene ID 2986
mRNA Refseq NM_001522
Protein Refseq NP_001513
MIM 300041
UniProt ID P51841

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GUCY2F Products

Required fields are marked with *

My Review for All GUCY2F Products

Required fields are marked with *

0
cart-icon
0
compare icon