Recombinant Human HBG1 protein, GST-tagged
Cat.No. : | HBG1-30144H |
Product Overview : | Recombinant Human HBG1 (1-118 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | Met1-His118 |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
AA Sequence : | MGHFTEEDKATITSLWGKVNVEDAGGETLGRLLVVYPWTQRFFDSFGNLSSASAIMGNPKVKAHGKKVLTSLGDATKHLDDLKGTFAQLSELHCDKLHVDPENFKLLGNVLVTVLAIH |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | HBG1 hemoglobin, gamma A [ Homo sapiens ] |
Official Symbol | HBG1 |
Synonyms | HBG1; hemoglobin, gamma A; hemoglobin subunit gamma-1; hb F Agamma; gamma globin; A-gamma globin; gamma-1-globin; gamma A hemoglobin; hemoglobin gamma-1 chain; hemoglobin gamma-a chain; hemoglobin, gamma, regulator of; HBGA; HBGR; HSGGL1; PRO2979; |
Gene ID | 3047 |
mRNA Refseq | NM_000559 |
Protein Refseq | NP_000550 |
MIM | 142200 |
UniProt ID | P69891 |
◆ Recombinant Proteins | ||
HBG1-1209C | Recombinant Chicken HBG1 | +Inquiry |
HBG1-47H | Recombinant Human HBG1 Protein, Myc/DDK-tagged | +Inquiry |
HBG1-3692H | Recombinant Human HBG1 protein, His-tagged | +Inquiry |
HBG1-3494HF | Recombinant Full Length Human HBG1 Protein, GST-tagged | +Inquiry |
HBG1-62HFL | Recombinant Full Length Human HBG1 Protein, C-Flag-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
HBG1-5620HCL | Recombinant Human HBG1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HBG1 Products
Required fields are marked with *
My Review for All HBG1 Products
Required fields are marked with *