Recombinant Human HBG1 Protein, MYC/DDK-tagged, C13 and N15-labeled
| Cat.No. : | HBG1-040H |
| Product Overview : | HBG1 MS Standard C13 and N15-labeled recombinant protein (NP_000550) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | The gamma globin genes (HBG1 and HBG2) are normally expressed in the fetal liver, spleen and bone marrow. Two gamma chains together with two alpha chains constitute fetal hemoglobin (HbF) which is normally replaced by adult hemoglobin (HbA) at birth. In some beta-thalassemias and related conditions, gamma chain production continues into adulthood. The two types of gamma chains differ at residue 136 where glycine is found in the G-gamma product (HBG2) and alanine is found in the A-gamma product (HBG1). The former is predominant at birth. The order of the genes in the beta-globin cluster is: 5'-epsilon -- gamma-G -- gamma-A -- delta -- beta--3'. |
| Molecular Mass : | 16.1 kDa |
| AA Sequence : | MGHFTEEDKATITSLWGKVNVEDAGGETLGRLLVVYPWTQRFFDSFGNLSSASAIMGNPKVKAHGKKVLTSLGDAIKHLDDLKGTFAQLSELHCDKLHVDPENFKLLGNVLVTVLAIHFGKEFTPEVQASWQKMVTGVASALSSRYHTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | HBG1 hemoglobin subunit gamma 1 [ Homo sapiens (human) ] |
| Official Symbol | HBG1 |
| Synonyms | HBG1; hemoglobin subunit gamma 1; HBG-T2; HBGA; HBGR; HSGGL1; PRO2979; hemoglobin subunit gamma-1; A-gamma globin; gamma A hemoglobin; gamma globin; gamma-1-globin; hb F Agamma; hemoglobin gamma-1 chain; hemoglobin gamma-a chain; hemoglobin, gamma A; hemoglobin, gamma, regulator of; |
| Gene ID | 3047 |
| mRNA Refseq | NM_000559 |
| Protein Refseq | NP_000550 |
| MIM | 142200 |
| UniProt ID | P69891 |
| ◆ Recombinant Proteins | ||
| HBG1-20H | Recombinant Human HBG1 protein, His-Myc-tagged | +Inquiry |
| HBG1-13683H | Recombinant Human HBG1, GST-tagged | +Inquiry |
| HBG1-3494HF | Recombinant Full Length Human HBG1 Protein, GST-tagged | +Inquiry |
| HBG1-3692H | Recombinant Human HBG1 protein, His-tagged | +Inquiry |
| HBG1-4600H | Recombinant Human HBG1 Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| HBG1-5620HCL | Recombinant Human HBG1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HBG1 Products
Required fields are marked with *
My Review for All HBG1 Products
Required fields are marked with *
