Recombinant Human HDAC2 Protein, His tagged

Cat.No. : HDAC2-3565H
Product Overview : Recombinant human HDAC2 protein was expressed with c-terminal His-tag in high-5 cells using baculovirus expression system and purified by using conventional chromatography techniques.
Availability October 02, 2026
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Insect Cells
Tag : His
Protein Length : 1-488aa
Description : This gene product belongs to the histone deacetylase family. Histone deacetylases act via the formation of large multiprotein complexes, and are responsible for the deacetylation of lysine residues at the N-terminal regions of core histones (H2A, H2B, H3 and H4). This protein forms transcriptional repressor complexes by associating with many different proteins, including YY1, a mammalian zinc-finger transcription factor. Thus, it plays an important role in transcriptional regulation, cell cycle progression and developmental events. Alternative splicing results in multiple transcript variants.
Form : Liquid in. 20mM Tris-HCl buffer (pH 8.0) containing 20% glycerol, 0.1M NaCl,1mM DTT, 0.1mM PMSF
Molecular Mass : 56.4 kDa (496aa)
AASequence : MAYSQGGGKKKVCYYYDGDIGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKATAEEMTKYHSDEYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVAGAVKLNRQQTDMAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNFPMRDGIDDESYGQIFKPIISKVMEMYQPSAVVLQCGADSLSGDRLGCFNLTVKGHAKCVEVVKTFNLPLLMLGGGGYTIRNVARCWTYETAVALDCEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTPEYMEKIKQRLFENLRMLPHAPGVQMQAIPEDAVHEDSGDEDGEDPDKRISIRASDKRIACDEEFSDSEDEGEGGRRNVADHKKGAKKARIEEDKKETEDKKTDVKEEDKSKDNSGEKTDTKGTKSEQLSNP
Endotoxin : < 1 EU/μg of protein (determined by LAL method)
Purity : > 85% by SDS-PAGE
Applications : SDS-PAGE
Notes : For research use only. This product is not intended or approved for human, diagnostics or veterinary use.
Storage : Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles.
Concentration : 0.25 mg/mL (determined by Bradford assay)
Gene Name HDAC2 histone deacetylase 2 [ Homo sapiens (human) ]
Official Symbol HDAC2
Synonyms HDAC2; histone deacetylase 2; RPD3; YAF1; YY1-associated factor 1; transcriptional regulator homolog RPD3; HD2
Gene ID 3066
mRNA Refseq NM_001527
Protein Refseq NP_001518
MIM 605164
UniProt ID Q92769

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All HDAC2 Products

Required fields are marked with *

My Review for All HDAC2 Products

Required fields are marked with *

0
cart-icon
0
compare icon