Recombinant Human HAND1 Protein, His tagged
| Cat.No. : | HAND1-7171H |
| Product Overview : | Recombinant Human HAND1 Protein with His tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E. coli |
| Tag : | His |
| Protein Length : | 1-215 aa |
| Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : | Sterile PBS, pH7.4, 10% Glycerol |
| AA Sequence : | MGSSHHHHHHSSGLVPRGSHMGSMNLVGSYAHHHHHHHPHPAHPMLHEPFLFGPASRCHQERPYFQSWLLSPADAAPDFPAGGPPPAAAAAATAYGPDARPGQSPGRLEALGGRLGRRKGSGPKKERRRTESINSAFAELRECIPNVPADTKLSKIKTLRLATSYIAYLMDVLAKDAQSGDPEAFKAELKKADGGRESKRKRELQQHEGFPPALGPVEKRIKGRTGWPQQVWALELNQ |
| Endotoxin : | <1 EU/μg by LAL |
| Purity : | > 90% by SDS-PAGE |
| Concentration : | 1 mg/mL by BCA |
| Official Symbol | HAND1 |
| Synonyms | HAND1; heart and neural crest derivatives expressed 1; heart- and neural crest derivatives-expressed protein 1; bHLHa27; eHand; Hxt; Thing1; class A basic helix-loop-helix protein 27; extraembryonic tissues, heart, autonomic nervous system and neural crest derivatives-expressed protein 1 |
| Gene ID | 9421 |
| mRNA Refseq | NM_004821 |
| Protein Refseq | NP_004812 |
| MIM | 602406 |
| UniProt ID | O96004 |
| ◆ Recombinant Proteins | ||
| HAND1-2786R | Recombinant Rat HAND1 Protein | +Inquiry |
| HAND1-13662H | Recombinant Human HAND1, GST-tagged | +Inquiry |
| HAND1-6524C | Recombinant Chicken HAND1 | +Inquiry |
| HAND1-4566H | Recombinant Human HAND1 Protein, GST-tagged | +Inquiry |
| HAND1-7171H | Recombinant Human HAND1 Protein, His tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| HAND1-5639HCL | Recombinant Human HAND1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HAND1 Products
Required fields are marked with *
My Review for All HAND1 Products
Required fields are marked with *
