Recombinant Human HECTD3 protein, His-tagged
Cat.No. : | HECTD3-2442H |
Product Overview : | Recombinant Human HECTD3 protein(3-213 aa), fused to His tag, was expressed in E. coli. |
Availability | May 21, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 3-213 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | VMEGMDKETFEFKFGKELTFTTVLSDQQVVELIPGGAGIVVGYGDRSRFIQLVQKARLEESKEQVAAMQAGLLKVVPQAVLDLLTWQELEKKVCGDPEVTVDALRKLTRFEDFEPSDSRVQYFWEALNNFTNEDRSRFLRFVTGRSRLPARIYIYPDKLGYETTDALPESSTCSSTLFLPHYASAKVCEEKLRYAAYNCVAIDTDMSPWEE |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | HECTD3 HECT domain containing E3 ubiquitin protein ligase 3 [ Homo sapiens ] |
Official Symbol | HECTD3 |
Synonyms | HECTD3; HECT domain containing E3 ubiquitin protein ligase 3; HECT domain containing 3; E3 ubiquitin-protein ligase HECTD3; FLJ21156; HECT domain-containing protein 3; probable E3 ubiquitin-protein ligase HECTD3; RP11-69J16.1; FLJ31983; MGC161630; |
Gene ID | 79654 |
mRNA Refseq | NM_024602 |
Protein Refseq | NP_078878 |
UniProt ID | Q5T447 |
◆ Recombinant Proteins | ||
HECTD3-13727H | Recombinant Human HECTD3, GST-tagged | +Inquiry |
HECTD3-7562M | Recombinant Mouse HECTD3 Protein | +Inquiry |
HECTD3-2062R | Recombinant Rhesus monkey HECTD3 Protein, His-tagged | +Inquiry |
HECTD3-4618Z | Recombinant Zebrafish HECTD3 | +Inquiry |
HECTD3-2442H | Recombinant Human HECTD3 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
HECTD3-5590HCL | Recombinant Human HECTD3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All HECTD3 Products
Required fields are marked with *
My Review for All HECTD3 Products
Required fields are marked with *
0
Inquiry Basket