Recombinant Human HFE protein, His&Myc-tagged
| Cat.No. : | HFE-4467H |
| Product Overview : | Recombinant Human HFE protein(Q30201)(23-306aa), fused to N-terminal His tag and C-terminal Myc tag, was expressed in E. coli |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&Myc |
| Protein Length : | 23-306aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 40.2 kDa |
| AA Sequence : | RLLRSHSLHYLFMGASEQDLGLSLFEALGYVDDQLFVFYDHESRRVEPRTPWVSSRISSQMWLQLSQSLKGWDHMFTVDFWTIMENHNHSKESHTLQVILGCEMQEDNSTEGYWKYGYDGQDHLEFCPDTLDWRAAEPRAWPTKLEWERHKIRARQNRAYLERDCPAQLQQLLELGRGVLDQQVPPLVKVTHHVTSSVTTLRCRALNYYPQNITMKWLKDKQPMDAKEFEPKDVLPNGDGTYQGWITLAVPPGEEQRYTCQVEHPGLDQPLIVIWEPSPSGTLV |
| Purity : | Greater than 85% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | HFE hemochromatosis [ Homo sapiens ] |
| Official Symbol | HFE |
| Synonyms | HFE; hemochromatosis; hereditary hemochromatosis protein; high Fe; HLA H; MHC class I-like protein HFE; hereditary hemochromatosis protein HLA-H; HH; HFE1; HLA-H; MVCD7; TFQTL2; MGC103790; MGC:150812; dJ221C16.10.1; IMAGE:40125754; |
| Gene ID | 3077 |
| mRNA Refseq | NM_000410 |
| Protein Refseq | NP_000401 |
| MIM | 613609 |
| UniProt ID | Q30201 |
| ◆ Recombinant Proteins | ||
| HFE-7601M | Recombinant Mouse HFE Protein | +Inquiry |
| HFE-206H | Recombinant Human HFE Protein, MYC/DDK-tagged, C13 and N15-labeled | +Inquiry |
| HFE-4721H | Recombinant Human HFE Protein, GST-tagged | +Inquiry |
| HFE-1231H | Recombinant Human HFE Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| HFE-4467H | Recombinant Human HFE protein, His&Myc-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| HFE-5572HCL | Recombinant Human HFE 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HFE Products
Required fields are marked with *
My Review for All HFE Products
Required fields are marked with *
