Recombinant Human HIRA protein, His-tagged

• Cat.No.: HIRA-4353H
• Product Overview: Recombinant Human HIRA protein(850-1017 aa), fused with N-terminal His tag, was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 850-1017 aa
• Form: The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole.
• AASequence: SLSTWNLVSDKQDSLAQCADFRSSLPSQDAMLCSGPLAIIQGRTSNSGRQAARLFSVPHVVQQETTLAYLENQVAAALTLQSSHEYRHWLLVYARYLVNEGFEYRLREICKDLLGPVHYSTGSQWESTVVGLRKRELLKELLPVIGQNLRFQRLFTECQEQLDILRDK
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• Reconstitution: Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution.

Gene Information

• Gene Name: HIRA HIR histone cell cycle regulation defective homolog A (S. cerevisiae) [ Homo sapiens ]
• Official Symbol: HIRA
• Synonyms: HIRA; HIR histone cell cycle regulation defective homolog A (S. cerevisiae); HIR (histone cell cycle regulation defective) homolog A (S. cerevisiae) , TUPLE1; protein HIRA; DGCR1; DiGeorge critical region gene 1; TUP1; TUP1-like enhancer of split protein 1; TUPLE1
• Gene ID: 7290
• mRNA Refseq: NM_003325
• Protein Refseq: NP_003316
• MIM: 600237
• UniProt ID: P54198