Recombinant Human HIRA protein, His-tagged
| Cat.No. : | HIRA-4353H |
| Product Overview : | Recombinant Human HIRA protein(850-1017 aa), fused with N-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 850-1017 aa |
| Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole. |
| AASequence : | SLSTWNLVSDKQDSLAQCADFRSSLPSQDAMLCSGPLAIIQGRTSNSGRQAARLFSVPHVVQQETTLAYLENQVAAALTLQSSHEYRHWLLVYARYLVNEGFEYRLREICKDLLGPVHYSTGSQWESTVVGLRKRELLKELLPVIGQNLRFQRLFTECQEQLDILRDK |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
| Gene Name | HIRA HIR histone cell cycle regulation defective homolog A (S. cerevisiae) [ Homo sapiens ] |
| Official Symbol | HIRA |
| Synonyms | HIRA; HIR histone cell cycle regulation defective homolog A (S. cerevisiae); HIR (histone cell cycle regulation defective) homolog A (S. cerevisiae) , TUPLE1; protein HIRA; DGCR1; DiGeorge critical region gene 1; TUP1; TUP1-like enhancer of split protein 1; TUPLE1; |
| Gene ID | 7290 |
| mRNA Refseq | NM_003325 |
| Protein Refseq | NP_003316 |
| MIM | 600237 |
| UniProt ID | P54198 |
| ◆ Recombinant Proteins | ||
| HIRA-5805C | Recombinant Chicken HIRA | +Inquiry |
| HIRA-2785H | Recombinant Human HIRA protein(371-450 aa), C-His-tagged | +Inquiry |
| HIRA-1905R | Recombinant Rhesus Macaque HIRA Protein, His (Fc)-Avi-tagged | +Inquiry |
| HIRA-4353H | Recombinant Human HIRA protein, His-tagged | +Inquiry |
| HIRA-3562HF | Recombinant Full Length Human HIRA Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| HIRA-791HCL | Recombinant Human HIRA cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HIRA Products
Required fields are marked with *
My Review for All HIRA Products
Required fields are marked with *
