Recombinant Human HIRA protein, His-tagged
Cat.No. : | HIRA-4353H |
Product Overview : | Recombinant Human HIRA protein(850-1017 aa), fused with N-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 850-1017 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole. |
AASequence : | SLSTWNLVSDKQDSLAQCADFRSSLPSQDAMLCSGPLAIIQGRTSNSGRQAARLFSVPHVVQQETTLAYLENQVAAALTLQSSHEYRHWLLVYARYLVNEGFEYRLREICKDLLGPVHYSTGSQWESTVVGLRKRELLKELLPVIGQNLRFQRLFTECQEQLDILRDK |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
Gene Name | HIRA HIR histone cell cycle regulation defective homolog A (S. cerevisiae) [ Homo sapiens ] |
Official Symbol | HIRA |
Synonyms | HIRA; HIR histone cell cycle regulation defective homolog A (S. cerevisiae); HIR (histone cell cycle regulation defective) homolog A (S. cerevisiae) , TUPLE1; protein HIRA; DGCR1; DiGeorge critical region gene 1; TUP1; TUP1-like enhancer of split protein 1; TUPLE1; |
Gene ID | 7290 |
mRNA Refseq | NM_003325 |
Protein Refseq | NP_003316 |
MIM | 600237 |
UniProt ID | P54198 |
◆ Recombinant Proteins | ||
HIRA-7640M | Recombinant Mouse HIRA Protein | +Inquiry |
HIRA-4171M | Recombinant Mouse HIRA Protein, His (Fc)-Avi-tagged | +Inquiry |
HIRA-2785H | Recombinant Human HIRA protein(371-450 aa), C-His-tagged | +Inquiry |
HIRA-1905R | Recombinant Rhesus Macaque HIRA Protein, His (Fc)-Avi-tagged | +Inquiry |
HIRA-4770H | Recombinant Human HIRA Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
HIRA-791HCL | Recombinant Human HIRA cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HIRA Products
Required fields are marked with *
My Review for All HIRA Products
Required fields are marked with *