Recombinant Human HLA-DPA1 protein, His-tagged

• Cat.No.: HLA-DPA1-3427H
• Product Overview: Recombinant Human HLA-DPA1 protein(32-224 aa), fused to His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 32-224 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
• AA Sequence: IKADHVSTYAAFVQTHRPTGEFMFEFDEDEQFYVDLDKKETVWHLEEFGRAFSFEAQGGLANIAILNNNLNTLIQRSNHTQAANDPPEVTVFPKEPVELGQPNTLICHIDRFFPPVLNVTWLCNGEPVTEGVAESLFLPRTDYSFHKFHYLTFVPSAEDVYDCRVEHWGLDQPLLKHWEAQEPIQMPETTETV
• Purity: 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: HLA-DPA1 major histocompatibility complex, class II, DP alpha 1 [ Homo sapiens ]
• Official Symbol: HLA-DPA1
• Synonyms: HLA-DPA1; major histocompatibility complex, class II, DP alpha 1; HLA DP1A; HLA class II histocompatibility antigen, DP alpha 1 chain; MHC class II DPA1; HLA-SB alpha chain; MHC class II antigen; MHC class II DP3-alpha; Primed lymphocyte test-1; MHC class II HLA-DPA1 antigen; HLA class II histocompatibility antigen, DP alpha chain; PLT1; HLADP; HLASB; DP(W3); DP(W4); HLA-DP1A
• Gene ID: 3113
• mRNA Refseq: NM_001242524
• Protein Refseq: NP_001229453
• MIM: 142880
• UniProt ID: P20036