Recombinant Human HLA-DPA1 protein, His-tagged

Cat.No. : HLA-DPA1-3427H
Product Overview : Recombinant Human HLA-DPA1 protein(32-224 aa), fused to His tag, was expressed in E. coli.
Availability July 15, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 32-224 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
AA Sequence : IKADHVSTYAAFVQTHRPTGEFMFEFDEDEQFYVDLDKKETVWHLEEFGRAFSFEAQGGLANIAILNNNLNTLIQRSNHTQAANDPPEVTVFPKEPVELGQPNTLICHIDRFFPPVLNVTWLCNGEPVTEGVAESLFLPRTDYSFHKFHYLTFVPSAEDVYDCRVEHWGLDQPLLKHWEAQEPIQMPETTETV
Purity : 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.
Gene Name HLA-DPA1 major histocompatibility complex, class II, DP alpha 1 [ Homo sapiens ]
Official Symbol HLA-DPA1
Synonyms HLA-DPA1; major histocompatibility complex, class II, DP alpha 1; HLA DP1A; HLA class II histocompatibility antigen, DP alpha 1 chain; MHC class II DPA1; HLA-SB alpha chain; MHC class II antigen; MHC class II DP3-alpha; Primed lymphocyte test-1; MHC class II HLA-DPA1 antigen; HLA class II histocompatibility antigen, DP alpha chain; PLT1; HLADP; HLASB; DP(W3); DP(W4); HLA-DP1A;
Gene ID 3113
mRNA Refseq NM_001242524
Protein Refseq NP_001229453
MIM 142880
UniProt ID P20036

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All HLA-DPA1 Products

Required fields are marked with *

My Review for All HLA-DPA1 Products

Required fields are marked with *

0
cart-icon