Recombinant Human HLA-DRB1 protein, His&Myc-tagged
| Cat.No. : | HLA-DRB1-622H |
| Product Overview : | Recombinant Human HLA-DRB1 protein(P01911)(30-227aa), fused with N-terminal His tag and C-terminal Myc tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&Myc |
| Protein Length : | 30-227a.a. |
| Tag : | His&Myc |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 30.4 kDa |
| Purity : | Greater than 85% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
| AA Sequence : | GDTRPRFLWQPKRECHFFNGTERVRFLDRYFYNQEESVRFDSDVGEFRAVTELGRPDAEYWNSQKDILEQARAAVDTYCRHNYGVVESFTVQRRVQPKVTVYPSKTQPLQHHNLLVCSVSGFYPGSIEVRWFLNGQEEKAGMVSTGLIQNGDWTFQTLVMLETVPRSGEVYTCQVEHPSVTSPLTVEWRARSESAQSK |
| Gene Name | HLA-DRB1 major histocompatibility complex, class II, DR beta 1 [ Homo sapiens ] |
| Official Symbol | HLA-DRB1 |
| Synonyms | HLA-DRB1; major histocompatibility complex, class II, DR beta 1; HLA DR1B; DW2.2/DR2.2; MHC class II antigen; lymphocyte antigen DRB1; MHC class II HLA-DRw10-beta; human leucocyte antigen DRB1; MHC class II HLA-DR beta 1 chain; MHC class II HLA-DR-beta cell surface glycoprotein; HLA class II histocompatibility antigen, DR-1 beta chain; SS1; DRB1; DRw10; HLA-DRB; HLA-DR1B; FLJ75017; FLJ76359; |
| Gene ID | 3123 |
| mRNA Refseq | NM_001243965 |
| Protein Refseq | NP_001230894 |
| MIM | 142857 |
| UniProt ID | P01911 |
| ◆ Recombinant Proteins | ||
| HLA-DRB1-2946H | Recombinant Human HLA-DRB1 Protein (Gly30-Ser266), His tagged | +Inquiry |
| HLA-DRB1-1240H | Recombinant Human HLA-DRB1 Protein, His-SUMO/MYC-tagged | +Inquiry |
| HLA-DRB1-357H | Recombinant Human HLA-DRB1 Protein, His-tagged | +Inquiry |
| HLA-DRB1-4303H | Recombinant Human HLA-DRB1 protein, His-tagged | +Inquiry |
| RFL9160HF | Recombinant Full Length Human Hla Class Ii Histocompatibility Antigen, Drb1-12 Beta Chain(Hla-Drb1) Protein, His-Tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| HLA-DRB1-797HCL | Recombinant Human HLA-DRB1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HLA-DRB1 Products
Required fields are marked with *
My Review for All HLA-DRB1 Products
Required fields are marked with *
