Recombinant Human HLA-DRB1 protein, His-tagged
Cat.No. : | HLA-DRB1-4303H |
Product Overview : | Recombinant Human HLA-DRB1 protein(P01912)(31-266aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 31-266aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 31.1 kDa |
AA Sequence : | DTRPRFLEYSTSECHFFNGTERVRYLDRYFHNQEENVRFDSDVGEFRAVTELGRPDAEYWNSQKDLLEQKRGRVDNYCRHNYGVVESFTVQRRVHPKVTVYPSKTQPLQHHNLLVCSVSGFYPGSIEVRWFRNGQEEKTGVVSTGLIHNGDWTFQTLVMLETVPRSGEVYTCQVEHPSVTSPLTVEWRARSESAQSKMLSGVGGFVLGLLFLGAGLFIYFRNQKGHSGLQPRGFLS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
Gene Name | HLA-DRB1 major histocompatibility complex, class II, DR beta 1 [ Homo sapiens ] |
Official Symbol | HLA-DRB1 |
Synonyms | HLA-DRB1; major histocompatibility complex, class II, DR beta 1; HLA DR1B; DW2.2/DR2.2; MHC class II antigen; lymphocyte antigen DRB1; MHC class II HLA-DRw10-beta; human leucocyte antigen DRB1; MHC class II HLA-DR beta 1 chain; MHC class II HLA-DR-beta cell surface glycoprotein; HLA class II histocompatibility antigen, DR-1 beta chain; SS1; DRB1; DRw10; HLA-DRB; HLA-DR1B; FLJ75017; FLJ76359; |
Gene ID | 3123 |
mRNA Refseq | NM_001243965 |
Protein Refseq | NP_001230894 |
MIM | 142857 |
UniProt ID | P01911 |
◆ Recombinant Proteins | ||
HLA-DRB1-713H | Active Recombinant Human HLA-DRB1, Fc-tagged | +Inquiry |
HLA-DRB1-5089H | Recombinant Human HLA-DRB1, His-tagged | +Inquiry |
HLA-DRB1-4303H | Recombinant Human HLA-DRB1 protein, His-tagged | +Inquiry |
HLA-DRB1-4573H | Recombinant Human HLA-DRB1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
HLA-DRB1-2946H | Recombinant Human HLA-DRB1 Protein (Gly30-Ser266), His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
HLA-DRB1-797HCL | Recombinant Human HLA-DRB1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HLA-DRB1 Products
Required fields are marked with *
My Review for All HLA-DRB1 Products
Required fields are marked with *