Recombinant Human HLA-DRB4, GST-tagged
| Cat.No. : | HLA-DRB4-1209H |
| Product Overview : | Recombinant Human HLA-DRB4 encod-ing human HLA-DRB4 full-length ORF (30 a.a. - 266 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Protein Length : | 30-266 a.a. |
| Description : | HLA-DRB4 belongs to the HLA class II beta chain paralogues. This class II molecule is a heterodimer consisting of an alpha (DRA) and a beta (DRB) chain, both anchored in the membrane. It plays a central role in the immune system by presenting peptides derived from extracellular proteins. Class II molecules are expressed in antigen presenting cells (APC: B lymphocytes, dendritic cells, macrophages). The beta chain is approximately 26-28 kDa and its gene contains 6 exons. Exon one encodes the leader peptide, exons 2 and 3 encode the two extracellular domains, exon 4 encodes the transmembrane domain and exon 5 encodes the cytoplasmic tail. Within the DR molecule the beta chain contains all the polymorphisms specifying the peptide binding specificities. Typing for these polymorphisms is routinely done for bone marrow and kidney transplantation. DRB1 is expressed at a level five times higher than its paralogues DRB3, DRB4 and DRB5. The presence of DRB4 is linked with allelic variants of DRB1, otherwise it is omitted. |
| Molecular Mass : | 51.81 kDa |
| Sequence : | GDTQPRFLEQAKCECRFLNGTERVWNLIRYIYNQEEYARYNSDLGEYQAVTELGRPDAEYWNSQKDLLERRRAEVDTYCRYNYGVVESFTVQRRVQPKVTVYPSKTQPLQHHNLLVCSVNGFYPGSIEVRWFRNGQEEKAGVVSTGLIQNGDWTFQTLVMLETVPRSGEVYTCQVEHPSMMSPLTVQWSARSESAQSKMLSGVGGFVLGLLFLGTGLFIYFRNQKGHSGLQPTGLLS |
| Purification : | Glutathione Sepharose 4 Fast Flow |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Stability : | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
| OfficialSymbol : | HLA-DRB4 |
| Gene Name | HLA-DRB4 – major histocompatibility complex, class II, DR beta 4 [Homo sapiens] |
| Synonyms | DR4; DR-4; DRB4; HLA-DR4B; major histocompatibility complex, class II, DR beta 4; leukocyte antigen; MHC class2 antigen; MHC HLA DR-beta chain; MHC class II antigen DRB4; DRB1 transplantation antigen; human leucocyte antigen DRB4; MHC class II antigen HLA-DR-beta; HLA class II histocompatibility antigen, DR beta 4 chain |
| Gene ID | 3126 |
| mRNA Refseq | NM_021983 |
| Protein Refseq | NP_068818 |
| UniProt ID | P13760 |
| Chromosome Location | 6p21.3 |
| Pathway | Adaptive Immune System; Allograft rejection; Antigen processing and presentation; Asthma; Autoimmune thyroid disease; Cell adhesion molecules (CAMs) |
| Function | MHC class II receptor activity; peptide antigen binding; protein binding |
| ◆ Recombinant Proteins | ||
| HLA-DRB4-1209H | Recombinant Human HLA-DRB4, GST-tagged | +Inquiry |
| HLA-DRB4-3738H | Recombinant Human HLA-DRB4 protein, GST-tagged | +Inquiry |
| HLA-DRB4-2263H | Recombinant Human HLA-DRB4 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| HLA-DRB4-235HF | Recombinant Full Length Human HLA-DRB4 Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| HLA-DRB4-5492HCL | Recombinant Human HLA 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HLA-DRB4 Products
Required fields are marked with *
My Review for All HLA-DRB4 Products
Required fields are marked with *
