Recombinant Human HLA-DRB4 protein, GST-tagged

Cat.No. : HLA-DRB4-3738H
Product Overview : Recombinant Human HLA-DRB4 protein(1-266 aa), fused to GST tag, was expressed in E. coli.
Availability May 21, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : 1-266 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH.
AA Sequence : MVCLKLPGGSCMAALTVTLTVLSSPLALAGDTQPRFLEQAKCECHFLNGTERVWNLIRYIYNQEEYARYNSDLGEYQAVTELGRPDAEYWNSQKDLLERRRAEVDTYCRYNYGVVESFTVQRRVQPKVTVYPSKTQPLQHHNLLVCSVNGFYPGSIEVRWFRNGQEEKAGVVSTGLIQNGDWTFQTLVMLETVPRSGEVYTCQVEHPSMMSPLTVQWSARSESAQSKMLSGVGGFVLGLLFLGTGLFIYFRNQKGHSGLQPTGLLS
Purity : 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.
Gene Name HLA-DRB4 major histocompatibility complex, class II, DR beta 4 [ Homo sapiens ]
Official Symbol HLA-DRB4
Synonyms HLA-DRB4; major histocompatibility complex, class II, DR beta 4; HLA DR4B; DR4; DR-4; leukocyte antigen; MHC class2 antigen; MHC HLA DR-beta chain; MHC class II antigen DRB4; DRB1 transplantation antigen; human leucocyte antigen DRB4; MHC class II antigen HLA-DR-beta; HLA class II histocompatibility antigen, DR beta 4 chain; DRB4; HLA-DR4B;
Gene ID 3126
mRNA Refseq NM_021983
Protein Refseq NP_068818
UniProt ID P13762

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All HLA-DRB4 Products

Required fields are marked with *

My Review for All HLA-DRB4 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon