Recombinant Human HLA-DRB4 protein, GST-tagged
| Cat.No. : | HLA-DRB4-3738H |
| Product Overview : | Recombinant Human HLA-DRB4 protein(1-266 aa), fused to GST tag, was expressed in E. coli. |
| Availability | December 05, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 1-266 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH. |
| AA Sequence : | MVCLKLPGGSCMAALTVTLTVLSSPLALAGDTQPRFLEQAKCECHFLNGTERVWNLIRYIYNQEEYARYNSDLGEYQAVTELGRPDAEYWNSQKDLLERRRAEVDTYCRYNYGVVESFTVQRRVQPKVTVYPSKTQPLQHHNLLVCSVNGFYPGSIEVRWFRNGQEEKAGVVSTGLIQNGDWTFQTLVMLETVPRSGEVYTCQVEHPSMMSPLTVQWSARSESAQSKMLSGVGGFVLGLLFLGTGLFIYFRNQKGHSGLQPTGLLS |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | HLA-DRB4 major histocompatibility complex, class II, DR beta 4 [ Homo sapiens ] |
| Official Symbol | HLA-DRB4 |
| Synonyms | HLA-DRB4; major histocompatibility complex, class II, DR beta 4; HLA DR4B; DR4; DR-4; leukocyte antigen; MHC class2 antigen; MHC HLA DR-beta chain; MHC class II antigen DRB4; DRB1 transplantation antigen; human leucocyte antigen DRB4; MHC class II antigen HLA-DR-beta; HLA class II histocompatibility antigen, DR beta 4 chain; DRB4; HLA-DR4B; |
| Gene ID | 3126 |
| mRNA Refseq | NM_021983 |
| Protein Refseq | NP_068818 |
| UniProt ID | P13762 |
| ◆ Recombinant Proteins | ||
| HLA-DRB4-1209H | Recombinant Human HLA-DRB4, GST-tagged | +Inquiry |
| HLA-DRB4-3738H | Recombinant Human HLA-DRB4 protein, GST-tagged | +Inquiry |
| HLA-DRB4-235HF | Recombinant Full Length Human HLA-DRB4 Protein, GST-tagged | +Inquiry |
| HLA-DRB4-2263H | Recombinant Human HLA-DRB4 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| HLA-DRB4-5492HCL | Recombinant Human HLA 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HLA-DRB4 Products
Required fields are marked with *
My Review for All HLA-DRB4 Products
Required fields are marked with *
