Recombinant Human HLA-G protein
Cat.No. : | HLA-G-38H |
Product Overview : | Recombinant Human HLA-G(25 to 338) fused with His tag at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 25-338 a.a. |
Description : | HLA-G belongs to the HLA class I heavy chain paralogues. This class I molecule is a heterodimer consisting of a heavy chain and a light chain (beta-2 microglobulin). The heavy chain is anchored in the membrane. HLA-G is expressed on fetal derived placental cells. The heavy chain is approximately 45 kDa and its gene contains 8 exons. Exon one encodes the leader peptide, exons 2 and 3 encode the alpha1 and alpha2 domain, which both bind the peptide, exon 4 encodes the alpha3 domain, exon 5 encodes the transmembrane region, and exon 6 encodes the cytoplasmic tail. |
Molecular Mass : | 38 kDa |
AA Sequence : | GSHSMRYFSAAVSRPGRGEPRFIAMGYVDDTQFVRFDSDSACPRMEPRAP WVEQEGPEYWEEETRNTKAHAQTDRMNLQTLRGYYNQSEASSHTLQWMIG CDLGSDGRLLRGYEQYAYDGKDYLALNEDLRSWTAADTAAQISKRKCEAA NVAEQRRAYLEGTCVEWLHRYLENGKEMLQRADPPKTHVTHHPVFDYEAT LRCWALGFYPAEIILTWQRDGEDQTQDVELVETRPAGDGTFQKWAAVVVP SGEEQRYTCHVQHEGLPEPLMLRWKQSSLPTIPIMGIVAGLVVLAAVVTG AAVAAVLWRKKSSD |
Purity : | > 95 % by SDS-PAGE. |
Storage : | Store at -80 centigrade. |
Concentration : | 20 µg at 0.2 mg/ml |
Gene Name | HLA-G major histocompatibility complex, class I, G [ Homo sapiens ] |
Official Symbol | HLA-G |
Synonyms | HLA-G; major histocompatibility complex, class I, G; HLA G histocompatibility antigen, class I, G; HLA class I histocompatibility antigen, alpha chain G; b2 microglobulin; HLA G antigen; HLA class I molecule; MHC class I antigen G; HLA-G histocompatibility antigen, class I, G; MHC-G; |
Gene ID | 3135 |
mRNA Refseq | NM_002127 |
Protein Refseq | NP_002118 |
MIM | 142871 |
UniProt ID | P17693 |
Chromosome Location | 6p21.3 |
Pathway | Adaptive Immune System, organism-specific biosystem; Allograft rejection, organism-specific biosystem; Allograft rejection, conserved biosystem; Antigen Presentation: Folding, assembly and peptide loading of class I MHC, organism-specific biosystem; Antigen processing and presentation, organism-specific biosystem; Antigen processing and presentation, conserved biosystem; Antigen processing-Cross presentation, organism-specific biosystem; |
Function | MHC class I receptor activity; protein homodimerization activity; receptor binding; |
◆ Recombinant Proteins | ||
HLA-G-4305H | Recombinant Human HLA-G protein, His-B2M-tagged | +Inquiry |
HLA-G-033H | Recombinant Human HLA-G Protein, His-tagged | +Inquiry |
HLA-G-13828H | Recombinant Human HLA-G, GST-tagged | +Inquiry |
HLA-G-3322H | Recombinant Human HLA-G protein, His-tagged | +Inquiry |
HLA-G-38H | Recombinant Human HLA-G protein | +Inquiry |
◆ Native Proteins | ||
HLA-G-1242H | Recombinant Human HLA-G & B2M Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
HLA-G-5493HCL | Recombinant Human HLA 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All HLA-G Products
Required fields are marked with *
My Review for All HLA-G Products
Required fields are marked with *
0
Inquiry Basket