Recombinant Human HLCS protein, His-tagged
Cat.No. : | HLCS-7855H |
Product Overview : | Recombinant Human HLCS protein(544-726 aa), fused with N-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 544-726 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. |
AASequence : | LMSVAVVEAVRSIPEYQDINLRVKWPNDIYYSDLMKIGGVLVNSTLMGETFYILIGCGFNVTNSNPTICINDLITEYNKQHKAELKPLRADYLIARVVTVLEKLIKEFQDKGPNSVLPLYYRYWVHSGQQVHLGSAEGPKVSIVGLDDSGFLQVHQEGGEVVTVHPDGNSFDMLRNLILPKRR |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
Gene Name | HLCS holocarboxylase synthetase (biotin-(proprionyl-CoA-carboxylase (ATP-hydrolysing)) ligase) [ Homo sapiens ] |
Official Symbol | HLCS |
Synonyms | HLCS; holocarboxylase synthetase (biotin-(proprionyl-CoA-carboxylase (ATP-hydrolysing)) ligase); holocarboxylase synthetase (biotin (proprionyl Coenzyme A carboxylase (ATP hydrolysing)) ligase) , holocarboxylase synthetase (biotin [proprionyl Coenzyme A carboxylase (ATP hydrolysing)] ligase); biotin--protein ligase; HCS; biotin apo-protein ligase; biotin--[acetyl-CoA-carboxylase] ligase; biotin--[methylcrotonoyl-CoA-carboxylase] ligase; biotin--[methylmalonyl-CoA-carboxytransferase] ligase; holocarboxylase synthetase (biotin-(proprionyl-Coenzyme A-carboxylase (ATP-hydrolysing)) ligase); |
Gene ID | 3141 |
mRNA Refseq | NM_000411 |
Protein Refseq | NP_000402 |
MIM | 609018 |
UniProt ID | P50747 |
◆ Recombinant Proteins | ||
HLCS-3632HF | Recombinant Full Length Human HLCS Protein, GST-tagged | +Inquiry |
Hlcs-491M | Recombinant Mouse Hlcs Protein, MYC/DDK-tagged | +Inquiry |
HLCS-2244H | Recombinant Human HLCS Protein, His-tagged | +Inquiry |
HLCS-4850H | Recombinant Human HLCS Protein, GST-tagged | +Inquiry |
HLCS-7854H | Recombinant Human HLCS protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
HLCS-5491HCL | Recombinant Human HLCS 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HLCS Products
Required fields are marked with *
My Review for All HLCS Products
Required fields are marked with *