Recombinant Human HMGB3 protein, GST-tagged
Cat.No. : | HMGB3-301335H |
Product Overview : | Recombinant Human HMGB3 protein(1-103 aa), fused with N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1-103 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
AA Sequence : | MAKGDPKKPKGKMSAYAFFVQTCREEHKKKNPEVPVNFAEFSKKCSERWKTMSGKEKSKFDEMAKADKVRYDREMKDYGPAKGGKKKKDPNAPKRPPSGFFLF |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Official Symbol | HMGB3 |
Synonyms | HMGB3; high mobility group box 3; high mobility group (nonhistone chromosomal) protein 4 , high mobility group box 3 , HMG4; high mobility group protein B3; HMG2A; MGC90319; non histone chromosomal protein; high-mobility group box 3; high mobility group protein 4; high mobility group protein 2a; non-histone chromosomal protein; high-mobility group (nonhistone chromosomal) protein 4; HMG4; HMG-4; HMG-2a; |
Gene ID | 3149 |
mRNA Refseq | NM_005342 |
Protein Refseq | NP_005333 |
MIM | 300193 |
UniProt ID | O15347 |
◆ Recombinant Proteins | ||
HMGB3-3645HF | Recombinant Full Length Human HMGB3 Protein, GST-tagged | +Inquiry |
Hmgb3-1627R | Recombinant Rat Hmgb3 Protein, His-tagged | +Inquiry |
HMGB3-3356H | Recombinant Human HMGB3 Protein (Ser14-Ala176), N-His tagged | +Inquiry |
HMGB3-4238M | Recombinant Mouse HMGB3 Protein, His (Fc)-Avi-tagged | +Inquiry |
HMGB3-15882H | Recombinant Human HMGB3, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
HMGB3-801HCL | Recombinant Human HMGB3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All HMGB3 Products
Required fields are marked with *
My Review for All HMGB3 Products
Required fields are marked with *
0
Inquiry Basket