Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at AACR Annual Meeting|Apr. 5-10, 2024|Booth #2953

Recombinant Human HP Protein, His-tagged

Cat.No. : HP-715H
Product Overview : Recombinant Human HP, transcript variant 1, fused with His tag at C-terminal was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
Description : This gene encodes a preproprotein, which is processed to yield both alpha and beta chains, which subsequently combine as a tetramer to produce haptoglobin. Haptoglobin functions to bind free plasma hemoglobin, which allows degradative enzymes to gain access to the hemoglobin, while at the same time preventing loss of iron through the kidneys and protecting the kidneys from damage by hemoglobin. Mutations in this gene and/or its regulatory regions cause ahaptoglobinemia or hypohaptoglobinemia. This gene has also been linked to diabetic nephropathy, the incidence of coronary artery disease in type 1 diabetes, Crohn's disease, inflammatory disease behavior, primary sclerosing cholangitis, susceptibility to idiopathic Parkinson's disease, and a reduced incidence of Plasmodium falciparum malaria. The protein encoded also exhibits antimicrobial activity against bacteria. A similar duplicated gene is located next to this gene on chromosome 16. Multiple transcript variants encoding different isoforms have been found for this gene.
Source : HEK293 cells
Species : Human
Tag : His
Form : Lyophilized from a 0.2 µM filtered solution of 20mM PB, 150mM NaCl, pH7.2
Molecular Mass : 44.4kD
AA Sequence : VDSGNDVTDIADDGCPKPPEIAHGY VEHSVRYQCKNYYKLRTEGDGVYTL NDKKQWINKAVGDKLPECEADDGCP KPPEIAHGYVEHSVRYQCKNYYKLR TEGDGVYTL NNEKQWINKAVGDKLPECEAVCGKPKNPANPVQRILGGHLD AKGSFPWQAKMVSHHNLTTGATLIN EQWLLTTAKNLFLNHSENATAKDIA PTLTLYVGKKQLVEIEKVVLHPNYS QVDIGLIKLKQKVSVNERVMPICLP SKDYAEVGRVGYVSGWGRNANFKFT DHLKYVMLPVADQDQCIRHYEGSTV PEKKTPKSPVGVQPILNEHTFCAGM SKYQEDTCYGDAGSAFAVHDLEEDT WYATGILSFDKSCAVAEYGVYVKVT SIQDWVQKTIAENVDHHHHHH
Endotoxin : Endotoxin level is <0.1 ng/µg of protein (<1EU/µg).
Purity : >95% as determined by SDS-PAGE and Coomassie blue staining
Concentration : Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Gene Name : HP haptoglobin [ Homo sapiens ]
Official Symbol : HP
Synonyms : HP; haptoglobin; zonulin; binding peptide; haptoglobin alpha(1S)-beta; haptoglobin alpha(2FS)-beta; haptoglobin, beta polypeptide; haptoglobin, alpha polypeptide; BP; HPA1S; HP2ALPHA2; MGC111141;
Gene ID : 3240
mRNA Refseq : NM_001126102
Protein Refseq : NP_001119574
MIM : 140100
UniProt ID : P00738

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

  • Q&As
  • Reviews

Q&As (5)

Ask a question
Can Haptoglobin levels be influenced by genetic factors? 05/20/2020

Yes, genetic variations can affect Haptoglobin levels, and understanding these variations can be crucial for personalized medicine approaches.

How does Haptoglobin contribute to the body's defense against oxidative stress? 01/20/2020

Haptoglobin acts as an antioxidant by binding to free hemoglobin, preventing the formation of reactive oxygen species that contribute to oxidative stress.

Are there any specific diseases where monitoring Haptoglobin is particularly crucial? 02/28/2019

Conditions such as hemolytic anemias, infections, and chronic inflammatory diseases often require monitoring Haptoglobin levels for diagnostic and prognostic purposes.

How is the Haptoglobin test performed in a clinical setting? 10/19/2017

The Haptoglobin test is usually conducted through a blood sample, and the serum or plasma is analyzed for Haptoglobin levels.

Can Haptoglobin be a diagnostic marker for conditions other than hemolysis and inflammation? 01/09/2016

Yes, altered levels of Haptoglobin are associated with various conditions, including cardiovascular diseases, infections, and certain cancers.

Customer Reviews (3)

Write a review
Reviews
07/02/2022

    Its superior purity and stability ensure reliable and reproducible results, providing me with confidence in the integrity of my experiments.

    01/18/2020

      Its impeccable purity and stability ensure accurate and reproducible results, giving me confidence in the reliability of my research outcomes

      07/07/2019

        Whether I am investigating protein-protein interactions, studying enzymatic activity, or conducting protein structure analyses, the HP protein consistently delivers exceptional performance and accurate results.

        Ask a Question for All HP Products

        Required fields are marked with *

        My Review for All HP Products

        Required fields are marked with *

        0

        Inquiry Basket

        cartIcon
        logo

        FOLLOW US

        Terms and Conditions        Privacy Policy

        Copyright © 2024 Creative BioMart. All Rights Reserved.

        Contact Us

        • /

        Stay Updated on the Latest Bioscience Trends