Recombinant Human HP Protein, His-tagged
Cat.No. : | HP-715H |
Product Overview : | Recombinant Human HP, transcript variant 1, fused with His tag at C-terminal was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
Description : | This gene encodes a preproprotein, which is processed to yield both alpha and beta chains, which subsequently combine as a tetramer to produce haptoglobin. Haptoglobin functions to bind free plasma hemoglobin, which allows degradative enzymes to gain access to the hemoglobin, while at the same time preventing loss of iron through the kidneys and protecting the kidneys from damage by hemoglobin. Mutations in this gene and/or its regulatory regions cause ahaptoglobinemia or hypohaptoglobinemia. This gene has also been linked to diabetic nephropathy, the incidence of coronary artery disease in type 1 diabetes, Crohn's disease, inflammatory disease behavior, primary sclerosing cholangitis, susceptibility to idiopathic Parkinson's disease, and a reduced incidence of Plasmodium falciparum malaria. The protein encoded also exhibits antimicrobial activity against bacteria. A similar duplicated gene is located next to this gene on chromosome 16. Multiple transcript variants encoding different isoforms have been found for this gene. |
Source : | HEK293 cells |
Species : | Human |
Tag : | His |
Form : | Lyophilized from a 0.2 µM filtered solution of 20mM PB, 150mM NaCl, pH7.2 |
Molecular Mass : | 44.4kD |
AA Sequence : | VDSGNDVTDIADDGCPKPPEIAHGY VEHSVRYQCKNYYKLRTEGDGVYTL NDKKQWINKAVGDKLPECEADDGCP KPPEIAHGYVEHSVRYQCKNYYKLR TEGDGVYTL NNEKQWINKAVGDKLPECEAVCGKPKNPANPVQRILGGHLD AKGSFPWQAKMVSHHNLTTGATLIN EQWLLTTAKNLFLNHSENATAKDIA PTLTLYVGKKQLVEIEKVVLHPNYS QVDIGLIKLKQKVSVNERVMPICLP SKDYAEVGRVGYVSGWGRNANFKFT DHLKYVMLPVADQDQCIRHYEGSTV PEKKTPKSPVGVQPILNEHTFCAGM SKYQEDTCYGDAGSAFAVHDLEEDT WYATGILSFDKSCAVAEYGVYVKVT SIQDWVQKTIAENVDHHHHHH |
Endotoxin : | Endotoxin level is <0.1 ng/µg of protein (<1EU/µg). |
Purity : | >95% as determined by SDS-PAGE and Coomassie blue staining |
Concentration : | Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
Gene Name : | HP haptoglobin [ Homo sapiens ] |
Official Symbol : | HP |
Synonyms : | HP; haptoglobin; zonulin; binding peptide; haptoglobin alpha(1S)-beta; haptoglobin alpha(2FS)-beta; haptoglobin, beta polypeptide; haptoglobin, alpha polypeptide; BP; HPA1S; HP2ALPHA2; MGC111141; |
Gene ID : | 3240 |
mRNA Refseq : | NM_001126102 |
Protein Refseq : | NP_001119574 |
MIM : | 140100 |
UniProt ID : | P00738 |
Products Types
◆ Recombinant Protein | ||
HP-2770G | Recombinant Goat HP Protein, His&SUMO-tagged | +Inquiry |
HP-957R | Recombinant Rat Haptoglobin Protein (Met1-Asn347), His-tagged | +Inquiry |
HP-2550R | Recombinant Rat HP Protein, His (Fc)-Avi-tagged | +Inquiry |
HP-5001H | Recombinant Human HP Protein, GST-tagged | +Inquiry |
HP-1955R | Recombinant Rhesus Macaque HP Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Protein | ||
HP-75C | Native Canine Haptoglobin | +Inquiry |
HP-8153H | Native Human Serum Haptoglobin | +Inquiry |
HP-7761R | Native Rabbit Haptoglobin Protein | +Inquiry |
◆ Lysates | ||
HP-5408HCL | Recombinant Human HP 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
- Q&As
- Reviews
Q&As (5)
Ask a questionYes, genetic variations can affect Haptoglobin levels, and understanding these variations can be crucial for personalized medicine approaches.
Haptoglobin acts as an antioxidant by binding to free hemoglobin, preventing the formation of reactive oxygen species that contribute to oxidative stress.
Conditions such as hemolytic anemias, infections, and chronic inflammatory diseases often require monitoring Haptoglobin levels for diagnostic and prognostic purposes.
The Haptoglobin test is usually conducted through a blood sample, and the serum or plasma is analyzed for Haptoglobin levels.
Yes, altered levels of Haptoglobin are associated with various conditions, including cardiovascular diseases, infections, and certain cancers.
Customer Reviews (3)
Write a reviewIts superior purity and stability ensure reliable and reproducible results, providing me with confidence in the integrity of my experiments.
Its impeccable purity and stability ensure accurate and reproducible results, giving me confidence in the reliability of my research outcomes
Whether I am investigating protein-protein interactions, studying enzymatic activity, or conducting protein structure analyses, the HP protein consistently delivers exceptional performance and accurate results.
Ask a Question for All HP Products
Required fields are marked with *
My Review for All HP Products
Required fields are marked with *
Inquiry Basket