Recombinant Human HS3ST4 Protein, GST-tagged

Cat.No. : HS3ST4-5055H
Product Overview : Human HS3ST4 partial ORF ( NP_006031.1, 358 a.a. - 455 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes the enzyme heparan sulfate D-glucosaminyl 3-O-sulfotransferase 4. This enzyme generates 3-O-sulfated glucosaminyl residues in heparan sulfate. Cell surface heparan sulfate is used as a receptor by herpes simplex virus type 1 (HSV-1), and expression of this gene is thought to play a role in HSV-1 pathogenesis. [provided by RefSeq
Molecular Mass : 36.52 kDa
AA Sequence : ERLIVDPAGEMAKVQDFLGLKRVVTKKHFYFNKTKGFPCLKKPEDSSAPRCLGKSKGRTHPRIDPDVIHRLRKFYKPFNLMFYQMTGQDFQWEQEEGD
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name HS3ST4 heparan sulfate (glucosamine) 3-O-sulfotransferase 4 [ Homo sapiens ]
Official Symbol HS3ST4
Synonyms HS3ST4; heparan sulfate (glucosamine) 3-O-sulfotransferase 4; heparan sulfate glucosamine 3-O-sulfotransferase 4; 3OST4; heparan sulfate 3-O-sulfotransferase 4; heparan sulfate 3-O-sulfotransferase-4; heparan sulfate D-glucosaminyl 3-O-sulfotransferase 4; 30ST4; 3-OST-4; h3-OST-4;
Gene ID 9951
mRNA Refseq NM_006040
Protein Refseq NP_006031
MIM 604059
UniProt ID Q9Y661

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All HS3ST4 Products

Required fields are marked with *

My Review for All HS3ST4 Products

Required fields are marked with *

0
cart-icon
0
compare icon