Recombinant Human HS3ST4 Protein, GST-tagged

• Cat.No.: HS3ST4-5055H
• Product Overview: Human HS3ST4 partial ORF ( NP_006031.1, 358 a.a. - 455 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene encodes the enzyme heparan sulfate D-glucosaminyl 3-O-sulfotransferase 4. This enzyme generates 3-O-sulfated glucosaminyl residues in heparan sulfate. Cell surface heparan sulfate is used as a receptor by herpes simplex virus type 1 (HSV-1), and expression of this gene is thought to play a role in HSV-1 pathogenesis. [provided by RefSeq
• Molecular Mass: 36.52 kDa
• AA Sequence: ERLIVDPAGEMAKVQDFLGLKRVVTKKHFYFNKTKGFPCLKKPEDSSAPRCLGKSKGRTHPRIDPDVIHRLRKFYKPFNLMFYQMTGQDFQWEQEEGD
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: HS3ST4 heparan sulfate (glucosamine) 3-O-sulfotransferase 4 [ Homo sapiens ]
• Official Symbol: HS3ST4
• Synonyms: HS3ST4; heparan sulfate (glucosamine) 3-O-sulfotransferase 4; heparan sulfate glucosamine 3-O-sulfotransferase 4; 3OST4; heparan sulfate 3-O-sulfotransferase 4; heparan sulfate 3-O-sulfotransferase-4; heparan sulfate D-glucosaminyl 3-O-sulfotransferase 4; 30ST4; 3-OST-4; h3-OST-4
• Gene ID: 9951
• mRNA Refseq: NM_006040
• Protein Refseq: NP_006031
• MIM: 604059
• UniProt ID: Q9Y661