Recombinant Human HSD17B11 protein, His&Myc-tagged
Cat.No. : | HSD17B11-3632H |
Product Overview : | Recombinant Human HSD17B11 protein(Q8NBQ5)(20-300aa), fused with N-terminal His tag and C-terminal Myc tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&Myc |
Protein Length : | 20-300a.a. |
Tag : | His&Myc |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 35.8 kDa |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | ESFVKLFIPKRRKSVTGEIVLITGAGHGIGRLTAYEFAKLKSKLVLWDINKHGLEETAAKCKGLGAKVHTFVVDCSNREDIYSSAKKVKAEIGDVSILVNNAGVVYTSDLFATQDPQIEKTFEVNVLAHFWTTKAFLPAMTKNNHGHIVTVASAAGHVSVPFLLAYCSSKFAAVGFHKTLTDELAALQITGVKTTCLCPNFVNTGFIKNPSTSLGPTLEPEEVVNRLMHGILTEQKMIFIPSSIAFLTTLERILPERFLAVLKQKISVKFDAVIGYKMKAQ |
Gene Name | HSD17B11 hydroxysteroid (17-beta) dehydrogenase 11 [ Homo sapiens ] |
Official Symbol | HSD17B11 |
Synonyms | HSD17B11; hydroxysteroid (17-beta) dehydrogenase 11; dehydrogenase/reductase (SDR family) member 8 , DHRS8; estradiol 17-beta-dehydrogenase 11; 17 BETA HSD11; 17 BETA HSDXI; PAN1B; retinal short chain dehydrogenase/reductase 2; RetSDR2; SDR16C2; short chain dehydrogenase/reductase family 16C; member 2; 17-BETA-HSD11; 17-BETA-HSDXI; 17-beta-HSD 11; 17-beta-HSD XI; CTCL tumor antigen HD-CL-03; CTCL-associated antigen HD-CL-03; 17-beta-hydroxysteroid dehydrogenase 11; 17-beta-hydroxysteroid dehydrogenase XI; T-cell lymphoma-associated antigen HD-CL-03; dehydrogenase/reductase SDR family member 8; 17-beta-hydroxysteroid dehydrogenase type XI; dehydrogenase/reductase (SDR family) member 8; retinal short-chain dehydrogenase/reductase 2; cutaneous T-cell lymphoma-associated antigen HD-CL-03; short chain dehydrogenase/reductase family 16C, member 2; DHRS8; RETSDR2; 17BHSD11; |
Gene ID | 51170 |
mRNA Refseq | NM_016245 |
Protein Refseq | NP_057329 |
MIM | 612831 |
UniProt ID | Q8NBQ5 |
◆ Recombinant Proteins | ||
HSD17B11-3548H | Recombinant Human HSD17B11 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
HSD17B11-943H | Recombinant Human HSD17B11, 20-285 aa, His-tagged | +Inquiry |
HSD17B11-53HFL | Recombinant Full Length Human HSD17B11 Protein, C-Flag-tagged | +Inquiry |
HSD17B11-4694H | Recombinant Human HSD17B11 protein, His-SUMO-tagged | +Inquiry |
HSD17B11-3842HF | Recombinant Full Length Human HSD17B11 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
HSD17B11-473HCL | Recombinant Human HSD17B11 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HSD17B11 Products
Required fields are marked with *
My Review for All HSD17B11 Products
Required fields are marked with *
0
Inquiry Basket