Recombinant Human HSD17B11 protein, His&Myc-tagged

Cat.No. : HSD17B11-3632H
Product Overview : Recombinant Human HSD17B11 protein(Q8NBQ5)(20-300aa), fused with N-terminal His tag and C-terminal Myc tag, was expressed in E.coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His&Myc
Protein Length : 20-300a.a.
Tag : His&Myc
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 35.8 kDa
Purity : Greater than 85% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
AA Sequence : ESFVKLFIPKRRKSVTGEIVLITGAGHGIGRLTAYEFAKLKSKLVLWDINKHGLEETAAKCKGLGAKVHTFVVDCSNREDIYSSAKKVKAEIGDVSILVNNAGVVYTSDLFATQDPQIEKTFEVNVLAHFWTTKAFLPAMTKNNHGHIVTVASAAGHVSVPFLLAYCSSKFAAVGFHKTLTDELAALQITGVKTTCLCPNFVNTGFIKNPSTSLGPTLEPEEVVNRLMHGILTEQKMIFIPSSIAFLTTLERILPERFLAVLKQKISVKFDAVIGYKMKAQ
Gene Name HSD17B11 hydroxysteroid (17-beta) dehydrogenase 11 [ Homo sapiens ]
Official Symbol HSD17B11
Synonyms HSD17B11; hydroxysteroid (17-beta) dehydrogenase 11; dehydrogenase/reductase (SDR family) member 8 , DHRS8; estradiol 17-beta-dehydrogenase 11; 17 BETA HSD11; 17 BETA HSDXI; PAN1B; retinal short chain dehydrogenase/reductase 2; RetSDR2; SDR16C2; short chain dehydrogenase/reductase family 16C; member 2; 17-BETA-HSD11; 17-BETA-HSDXI; 17-beta-HSD 11; 17-beta-HSD XI; CTCL tumor antigen HD-CL-03; CTCL-associated antigen HD-CL-03; 17-beta-hydroxysteroid dehydrogenase 11; 17-beta-hydroxysteroid dehydrogenase XI; T-cell lymphoma-associated antigen HD-CL-03; dehydrogenase/reductase SDR family member 8; 17-beta-hydroxysteroid dehydrogenase type XI; dehydrogenase/reductase (SDR family) member 8; retinal short-chain dehydrogenase/reductase 2; cutaneous T-cell lymphoma-associated antigen HD-CL-03; short chain dehydrogenase/reductase family 16C, member 2; DHRS8; RETSDR2; 17BHSD11;
Gene ID 51170
mRNA Refseq NM_016245
Protein Refseq NP_057329
MIM 612831
UniProt ID Q8NBQ5

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All HSD17B11 Products

Required fields are marked with *

My Review for All HSD17B11 Products

Required fields are marked with *

0
cart-icon