Recombinant Human HYAL2 Protein, GST-tagged

Cat.No. : HYAL2-5221H
Product Overview : Human HYAL2 partial ORF ( NP_003764, 340 a.a. - 439 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a protein which is similar in structure to hyaluronidases. Hyaluronidases intracellularly degrade hyaluronan, one of the major glycosaminoglycans of the extracellular matrix. Hyaluronan is thought to be involved in cell proliferation, migration and differentiation. Varying functions have been described for this protein. It has been described as a lysosomal hyaluronidase which is active at a pH below 4 and specifically hydrolyzes high molecular weight hyaluronan. It has also been described as a GPI-anchored cell surface protein which does not display hyaluronidase activity but does serve as a receptor for the oncogenic virus Jaagsiekte sheep retrovirus. The gene is one of several related genes in a region of chromosome 3p21.3 associated with tumor suppression. This gene encodes two alternatively spliced transcript variants which differ only in the 5 UTR. [provided by RefSeq
Molecular Mass : 36.74 kDa
AA Sequence : CQYLKDYLTRLLVPYVVNVSWATQYCSRAQCHGHGRCVRRNPSASTFLHLSTNSFRLVPGHAPGEPQLRPVGELSWADIDHLQTHFRCQCYLGWSGEQCQ
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name HYAL2 hyaluronoglucosaminidase 2 [ Homo sapiens ]
Official Symbol HYAL2
Synonyms HYAL2; hyaluronoglucosaminidase 2; hyaluronidase-2; hyaluronidase 2; LuCa 2; LUCA2; lysosomal hyaluronidase; PH 20 homolog; hyal-2; PH20 homolog; PH-20 homolog; lung carcinoma protein 2; hyaluronoglucosaminidase-2;
Gene ID 8692
mRNA Refseq NM_003773
Protein Refseq NP_003764
MIM 603551
UniProt ID Q12891

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All HYAL2 Products

Required fields are marked with *

My Review for All HYAL2 Products

Required fields are marked with *

0
cart-icon
0
compare icon