Recombinant Human ICAM4 protein, His-tagged
| Cat.No. : | ICAM4-3215H |
| Product Overview : | Recombinant Human ICAM4 protein(23-152 aa), fused to His tag, was expressed in E. coli. |
| Availability | February 01, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 23-152 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | ALGRRTKRAQSPKGSPLAPSGTSVPFWVRMSPEFVAVQPGKSVQLNCSNSCPQPQNSSLRTPLRQGKTLRGPGWVSYQLLDVRAWSSLAHCLVTCAGKTRWATSRITAYKPPHSVILEPPVLKGRKYTLR |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | ICAM4 intercellular adhesion molecule 4 (Landsteiner-Wiener blood group) [ Homo sapiens ] |
| Official Symbol | ICAM4 |
| Synonyms | ICAM4; intercellular adhesion molecule 4 (Landsteiner-Wiener blood group); intercellular adhesion molecule 4 (LW blood group) , intercellular adhesion molecule 4, Landsteiner Wiener blood group , Landsteiner Wiener blood group , LW; intercellular adhesion molecule 4; CD242; CD242 antigen; LW blood group protein; Landsteiner-Wiener blood group antigen a; Landsteiner-Wiener blood group glycoprotein; intercellular adhesion molecule 4 (LW blood group); LW; |
| Gene ID | 3386 |
| mRNA Refseq | NM_001039132 |
| Protein Refseq | NP_001034221 |
| MIM | 614088 |
| UniProt ID | Q14773 |
| ◆ Recombinant Proteins | ||
| Icam4-4877M | Recombinant Mouse Icam4 protein, His-SUMO-tagged | +Inquiry |
| ICAM4-4077H | Recombinant Human ICAM4 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| ICAM4-061H | Recombinant Human ICAM4 Protein, His-tagged | +Inquiry |
| Icam4-7129R | Recombinant Rat Icam4 protein, His & T7-tagged | +Inquiry |
| ICAM4-1619R | Recombinant Rhesus Monkey ICAM4 Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ICAM4-943HCL | Recombinant Human ICAM4 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ICAM4 Products
Required fields are marked with *
My Review for All ICAM4 Products
Required fields are marked with *
