| Description : |
Isocitrate dehydrogenases catalyze the oxidative decarboxylation of isocitrate to 2-oxoglutarate. These enzymes belong to two distinct subclasses, one of which utilizes NAD(+) as the electron acceptor and the other NADP(+). Five isocitrate dehydrogenases have been reported: three NAD(+)-dependent isocitrate dehydrogenases, which localize to the mitochondrial matrix, and two NADP(+)-dependent isocitrate dehydrogenases, one of which is mitochondrial and the other predominantly cytosolic. NAD(+)-dependent isocitrate dehydrogenases catalyze the allosterically regulated rate-limiting step of the tricarboxylic acid cycle. Each isozyme is a heterotetramer that is composed of two alpha subunits, one beta subunit, and one gamma subunit. The protein encoded by this gene is the gamma subunit of one isozyme of NAD(+)-dependent isocitrate dehydrogenase. This gene is a candidate gene for periventricular heterotopia. Several alternatively spliced transcript variants of this gene have been described, but only some of their full length natures have been determined. |
| Protein length : |
393 amino acids |
| Molecular Weight : |
69.340kDa inclusive of tags |
| Source : |
Wheat germ |
| Form : |
Liquid |
| Purity : |
Proprietary Purification |
| Storage buffer : |
pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
| Storage : |
Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : |
MALKVATVAGSAAKAVLGPALLCRPWEVLGAHEVPSRNIF SEQTIPPSAKYGGRHTVTMIPGDGIGPELMLHVKSVFRHA CVPVDFEEVHVSSNADEEDIRNAIMAIRRNRVALKGNIET NHNLPPSHKSRNNILRTSLDLYANVIHCKSLPGVVTRHKD IDILIVRENTEGEYSSLEHESVAGVVESLKIITKAKSLRI AEYAFKLAQESGRKKVTAVHKANIMKLGDGLFLQCCREVA ARYPQITFENMIVDNTTMQLVSRPQQFDVMVMPNLYGNIV NNVCAGLVGGPGLVAGANYGHVYAVFETATRNTGKSIANK NIANPTATLLASCMMLDHLKLHSYAASIRKAVLASMDNEN MHTPDIGGQGTTSEAIQDVIRHIRVINGRAVEA |
| Sequence Similarities : |
Belongs to the isocitrate and isopropylmalate dehydrogenases family. |
