Recombinant Human IFITM1 Protein, GST-tagged
Cat.No. : | IFITM1-45H |
Product Overview : | Recombinant Human IFITM Protein()() is expressed from E. coli with a GST Tag at the N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1-125 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectants before lyophilization. |
Bio-activity : | Not tested. |
AA Sequence : | MHKEEHEVAVLGAPPSTILPRSTVINIHSETSVPDHVVWSLFNTLFLNWCCLGFIAFAYSVKSRDRKMVGDVTGAQAYASTAKCLNIWALILGILMTIGFILLLVFGSVTVYHIMLQIIQEKRGY |
Endotoxin : | Please contact the lab for more information. |
Purity : | 80%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage (see Stability and Storage for more details). If a different concentration is needed for your purposes please adjust the reconstitution volume as required (please note: the ion concentration of the final solution will vary according to the volume used). Note: Centrifuge vial before opening. When reconstituting, gently pipet and wash down the sides of the vial to ensure full recovery of the protein into solution. |
Shipping : | The product is shipped at ambient temperature. Upon receipt, store it immediately at the recommended temperature (see below). |
Gene Name | IFITM1 |
Official Symbol | IFITM1 |
Synonyms | 9-27; CD225; IFI17; LEU13 |
Gene ID | 8519 |
mRNA Refseq | NM_003641.5 |
Protein Refseq | NP_003632.4 |
MIM | 604456 |
UniProt ID | P13164 |
◆ Recombinant Proteins | ||
IFITM1-3211H | Recombinant Human IFITM1 Protein (Met1-Phe57), C-SUMO tagged | +Inquiry |
IFITM1-4220H | Recombinant Human IFITM1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
IFITM1-45H | Recombinant Human IFITM1 Protein, GST-tagged | +Inquiry |
IFITM1-4434M | Recombinant Mouse IFITM1 Protein, His (Fc)-Avi-tagged | +Inquiry |
IFITM1-4316H | Recombinant Human IFITM1 protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IFITM1-5283HCL | Recombinant Human IFITM1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IFITM1 Products
Required fields are marked with *
My Review for All IFITM1 Products
Required fields are marked with *